KEGG   Acinetobacter pittii: BDGL_001056Help
Entry
BDGL_001056       CDS       T01684                                 

Definition
(RefSeq) hypothetical protein
Organism
acc  Acinetobacter pittii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nup54_C
Motif
Other DBs
NCBI-GeneID: 11639237
NCBI-ProteinID: YP_004995324
UniProt: F0KNJ3
LinkDB All DBs
Position
1105716..1106432
Genome map
AA seq 238 aa AA seqDB search
MNQCTYRIGCMSKDKLLPKNLEAMIKVIHDLSLSSQLSENWIYSDDNPDIYIIDLDSGYT
NILIPKKIKIVLSNNPELLKGYQYGLKRPLRYQELLKILLEIENNEYFKKSYRERIENIT
ATDPFETKILYKLVCYPNFKNIHSEQIVNVTRVCALLSIESKTVQEIKKFLNLSVDEIQK
IIEIIKKEAYPNYETIHENIVSILPFSNEVVQTTPPRMEQNLLLYFINKLWKKLKGEF
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaatgtacatatagaattggctgtatgtcaaaggataaactattgcctaaaaac
ttagaggcaatgataaaagttattcatgacttatctttatcctctcagctatctgaaaac
tggatatatagtgatgataatccagatatatatattattgatttagacagtggctataca
aatattcttattcctaaaaaaattaaaattgtattaagtaataaccctgagcttttaaaa
ggttatcaatatggattaaagaggcccttaaggtatcaggagcttttaaaaattttatta
gaaattgaaaataatgaatattttaaaaaatcttatcgagaacgaatagaaaatataact
gctacagatccgtttgagacaaaaattctatacaaacttgtttgttatccaaactttaaa
aatattcattcagagcagattgttaatgtcactagagtttgtgctttattatctattgaa
tcaaagacagtccaagaaattaaaaaattcttgaacttatctgtagatgaaatacaaaaa
attatagagattattaaaaaagaggcttatccgaactatgaaacgatacatgagaatatt
gtctcgatattgccgttttcaaatgaagttgttcagacaacacctccaaggatggagcaa
aacttattgctctattttataaataaactttggaagaagttaaaaggagaattctga

DBGET integrated database retrieval system