KEGG   Acinetobacter pittii: BDGL_001063Help
Entry
BDGL_001063       CDS       T01684                                 

Gene name
acoC
Definition
(RefSeq) acoC; dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
acc  Acinetobacter pittii
Pathway
acc00010  Glycolysis / Gluconeogenesis
acc00020  Citrate cycle (TCA cycle)
acc00620  Pyruvate metabolism
acc01100  Metabolic pathways
acc01110  Biosynthesis of secondary metabolites
acc01120  Microbial metabolism in diverse environments
acc01130  Biosynthesis of antibiotics
acc01200  Carbon metabolism
Module
acc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:acc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BDGL_001063 (acoC)
   00020 Citrate cycle (TCA cycle)
    BDGL_001063 (acoC)
   00620 Pyruvate metabolism
    BDGL_001063 (acoC)
Enzymes [BR:acc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BDGL_001063 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 11639244
NCBI-ProteinID: YP_004995331
UniProt: F0KNK0
LinkDB All DBs
Position
1113697..1115187
Genome map
AA seq 496 aa AA seqDB search
MEEGTIAQWLIKEGDSFNKGDEICEIETTKIVNVLEAPFAGTLRKILAKDGDTLPVGGLI
AVCAESQVSDAEIEQFIASLGGSAAKAPEAPSEQSKAETSAPVAEKAEQPQSVAASAPVP
VKTAKGDYAVPESLQGYQASDELFTTPHALKLAEKHNVNLAKVTGSGREGRISVQDIQKA
VQAAGGQWPDIKQQTQAKVVKSTADDSQVSATPVARRLAKKWGINLNDCRVSGTRGRVCK
EDVEAVYYRNNPTSVNEQSVQCAAQPQSTVTTVAMNGMRKAIASRLQAAKRNAPHFRLVV
DLNVEALQKLRKQINEAVPQVKLSINDMLIKAAAAALIKVPEVNVQFDEATQSILQFSQA
DISVAVAIPNGLITPIVKAANQKSLAQISDDMRDLATRAKTGKLQPEEFQGGSFSISNLG
MLGIKQFDAIINPPQGAIMALGASESRAVVENGNVVVREIVTATLSCDHRVIDGAVGAKF
LASFKQFVENPALILV
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaggcacgattgcccaatggttgattaaagagggtgatagctttaataagggc
gatgaaatttgtgaaattgaaaccacaaaaatcgtcaatgtattagaagcgccttttgcg
ggaactctccgtaaaattttagcgaaagatggtgatactttacctgttggtggtcttatt
gccgtatgtgctgaaagccaagtttctgatgcagaaattgagcagtttattgcatcacta
ggtggttcagcagctaaggcccctgaagcaccttcggagcaaagtaaagcagaaacgtct
gcccctgttgctgaaaaagcagaacaaccacagtctgtagctgcaagtgctccagttcca
gtaaagactgctaaaggtgactacgctgtacccgagtcattacaaggctatcaagcatct
gatgagttgtttacaacaccgcatgcgttaaagcttgcagaaaagcacaatgtgaacttg
gcaaaagtcacaggttctggtcgtgaaggacgtattagtgttcaagacatccagaaagct
gtgcaggctgctggtggtcagtggcctgatattaagcagcaaactcaagctaaagtggtt
aaatctactgctgatgatagccaagtttcagcgacacctgtagcacgccgtttagcaaaa
aaatggggcattaacctaaatgactgccgtgtttcaggtactcgtggccgtgtctgtaaa
gaagatgttgaagcggtttactatcgtaataatccaacgtcggtaaatgaacaatctgtg
caatgtgcagctcaaccacaatcgaccgttactactgtcgcgatgaatggtatgcgtaag
gcgattgcttcacggttacaggctgcaaaacgtaatgcaccgcatttccgcttggtggtc
gatctcaacgtagaggctttgcaaaaactacgtaagcagattaatgaggctgttccacaa
gtgaaactttcaattaatgacatgctaattaaagcagctgctgcggcactaattaaagta
cctgaggtgaatgttcaatttgatgaagcgactcaatcaattttacagttctctcaagcg
gatatttcggtggctgtagcgattccaaacggtttaattacacccattgtgaaagctgca
aatcagaagtctttagcacaaatttctgatgacatgcgtgatttggcaacccgtgctaag
actggcaagttacaacctgaagagtttcagggcggcagctttagcatttcaaatttagga
atgttaggcattaagcagttcgacgccattattaatccaccgcaaggtgcaattatggca
ttaggtgcttctgaatcacgtgctgttgttgaaaatggcaatgtagtggttcgtgagatt
gtcacagcgacgttgtcatgtgatcaccgtgtcattgatggcgcagttggggcgaaattc
ttggccagctttaagcagtttgttgaaaaccctgctttaattttggtgtag

DBGET integrated database retrieval system