KEGG   Acinetobacter pittii: BDGL_001066Help
Entry
BDGL_001066       CDS       T01684                                 

Gene name
bdh1
Definition
(RefSeq) putative (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
acc  Acinetobacter pittii
Pathway
acc00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:acc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BDGL_001066 (bdh1)
Enzymes [BR:acc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BDGL_001066 (bdh1)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BDGL_001066 (bdh1)
    1.1.1.-  
     BDGL_001066 (bdh1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 Semialdhyde_dh FAD_binding_3 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 11639247
NCBI-ProteinID: YP_004995334
UniProt: F0KNK3
LinkDB All DBs
Position
1117443..1118501
Genome map
AA seq 352 aa AA seqDB search
MKAARFYDRGDIRIEDIPEPEVTPGTVGIKVAWCGICGTDLHEFMEGPIFIPPCGHPHPI
SGESAPITMGHEFSGVVYAVGEGVDDIEIGQHVVVEPYIVADDVPTGLGDNYHLSKNMNF
IGLGGRGGGLSEKIAVKRRWVHPISNKIPLDQAALIEPLSVGHHAFVRSGAKAGDIALVG
GAGPIGLLLSAILKAKGLKVIITELSAKRKEKAKESGVADYILDPSEVDVVSEVMKITNG
NGVDVAFECSSVNKVLDTLVAAVKPTGVIVIVSIWSHPASINVHSVVMKELDVRGTIAYV
NDHQETIKLVEEGKINLEPFITQRIQLDDLISQGFETLIHNNESAVKIIVQP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcgcgtttttatgacagaggcgatattcgtattgaagatatccctgaacca
gaagtgactcccggcactgtaggcattaaggtagcttggtgtggaatctgtggtacagat
ttgcatgagtttatggaagggccaatttttattccaccgtgtggacatccacatcctatt
tcaggtgaatctgcgccgattaccatgggacatgaattttcaggtgtagtctatgcagtt
ggtgaaggtgttgatgatattgaaattggtcagcatgtagtcgtagagccttatattgtg
gccgatgatgtgccgactggactgggcgataattatcatctttccaaaaatatgaacttt
attggtttaggcggtcgtggcggtggtttgtcggagaaaatagcagttaaacgccgttgg
gtgcatccaatttccaataaaatcccgctagatcaggcagccttaattgaacctttatcg
gttggtcatcatgctttcgtacgtagtggtgcaaaggctggtgatattgcactggttgga
ggtgcgggcccaattggtttattgctttcggcaattttaaaagcgaaagggctcaaggtt
atcattaccgagttaagtgcaaaacgtaaagaaaaagccaaagagtcgggtgttgcagat
tatattttagacccgtcagaagttgatgttgtttctgaggtcatgaaaattactaatggt
aatggcgtcgatgttgcatttgaatgtagtagcgttaacaaggtattagatactttggtt
gcggcagtcaaaccaacaggtgttattgttattgtttcgatttggagccatccagcatca
attaacgtgcacagtgtggtaatgaaagaacttgatgtacgaggcacaattgcctatgta
aatgaccatcaagaaaccattaaactggtcgaagaaggtaaaataaatctggaacctttt
attacacagcgcatccaacttgatgatttgatttcacaaggctttgaaaccttaattcat
aacaatgaatcagctgttaagattattgtacagccctaa

DBGET integrated database retrieval system