KEGG   Acinetobacter pittii: BDGL_001073Help
Entry
BDGL_001073       CDS       T01684                                 

Gene name
hom
Definition
(RefSeq) putative homoserine dehydrogenase (HDH)
  KO
K00003  homoserine dehydrogenase [EC:1.1.1.3]
Organism
acc  Acinetobacter pittii
Pathway
acc00260  Glycine, serine and threonine metabolism
acc00270  Cysteine and methionine metabolism
acc00300  Lysine biosynthesis
acc01100  Metabolic pathways
acc01110  Biosynthesis of secondary metabolites
acc01120  Microbial metabolism in diverse environments
acc01130  Biosynthesis of antibiotics
acc01230  Biosynthesis of amino acids
Module
acc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:acc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BDGL_001073 (hom)
   00270 Cysteine and methionine metabolism
    BDGL_001073 (hom)
   00300 Lysine biosynthesis
    BDGL_001073 (hom)
Enzymes [BR:acc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.3  homoserine dehydrogenase
     BDGL_001073 (hom)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Homoserine_dh NAD_binding_3 Gp_dh_N TrkA_N DapB_N ELFV_dehydrog 2-Hacid_dh_C 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 11639254
NCBI-ProteinID: YP_004995341
UniProt: F0KNL0
LinkDB All DBs
Position
1124418..1125422
Genome map
AA seq 334 aa AA seqDB search
MKQVNVAICGFGRIGQQIAELLLNRSNYYKQKYQINARLVGVCNSSSGLIDQEGLQASKW
LDKTKYQVGLTEQKFLEQVQADVIIETGPSDYVTGGKGLFYLDYALTHSMNAIAVSKGAL
VVDGKKLVNLAHQHNKKLFFSGATAAALPTVDLFEYNLAGCQILEIEGVFTGTTNFILND
MLQHECAFAESLEKAQAKGIAEPDSSFDVDGWDTAAKITILANTVLGADVQIQDIPRQGI
NHVTAEHIRDWKKENVIPRLVGFIHIKNQQIQTGVELRLVSANHPFAHLQGSNKCIRALT
QEMGEFVVSGGASAPLATAAAALKDFELMLKTGC
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaagttaacgtagcaatttgtggttttggacggattgggcaacaaattgcagag
cttcttttaaatcgatcgaactactataaacaaaaatatcaaattaatgcccgtttagtg
ggtgtctgcaactcatcatcaggtttaattgatcaagaaggtttacaagcttcaaagtgg
ctagataaaacaaaatatcaagtaggtctaactgagcaaaagtttttagaacaggttcaa
gcagatgtcattattgagacaggtccaagtgactatgtgacaggtggaaaaggcctattt
tatttagattatgctttaacacatagcatgaatgcgattgcggtatctaaaggtgcttta
gtcgtagatggtaaaaaattagttaacttggcacatcagcacaataaaaaactatttttt
agcggtgcgacagctgctgccttaccaactgttgatttgtttgaatataacttagctggc
tgccaaattttagaaatagaaggtgtgtttacaggcaccacgaattttattttgaatgat
atgttgcaacatgaatgtgcgtttgcagaatctcttgaaaaagctcaagcaaaaggtatt
gcagaacctgacagctctttcgatgtagatggatgggatactgctgccaaaattacgata
ctagccaatactgttttgggagctgatgtacaaattcaagatattccaagacaaggaatt
aatcacgttacggctgaacatattcgtgattggaaaaaagaaaatgtaattcctcgtctg
gtcggttttattcatattaagaatcagcaaattcaaaccggtgttgaattacgtttagtt
tcagcaaatcatccttttgctcatctgcaaggttccaataaatgcattcgggcgttaacg
caagaaatgggggaatttgttgtcagtggaggggcttctgcacctttagctacggcagct
gcagctttaaaagatttcgagttgatgctaaaaacgggctgctaa

DBGET integrated database retrieval system