KEGG   Acinetobacter pittii: BDGL_001835Help
Entry
BDGL_001835       CDS       T01684                                 

Gene name
sodB
Definition
(RefSeq) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
acc  Acinetobacter pittii
Brite
Enzymes [BR:acc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BDGL_001835 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 11640023
NCBI-ProteinID: YP_004996103
UniProt: F0KJ94
LinkDB All DBs
Position
1969797..1970423
Genome map
AA seq 208 aa AA seqDB search
MTTITLPALPYGYDDLAPHISKETLEYHHDKHHNTYVVNLNNLIKGTDLEGKTLEEIIKA
TAGDASKAGIFNNAAQVWNHTFYWNSMKPNGGGKPTGAIAAKIDEAFGSYEKFAEEFTAA
ATTQFGSGWAWLVADEVNGKLSITKTSNADTPLAHGQIAVLTIDVWEHAYYIDFRNLRPK
YIATFLESLVNWDYANAKLAGQPAGVEK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccattactttacctgcacttccatatggctatgatgatttagcgccacatatt
agtaaagaaactttagaataccatcacgataaacaccacaatacctatgttgttaactta
aacaacttaatcaaaggaactgaccttgaaggtaaaactttagaagaaatcatcaaagca
actgctggtgatgcatctaaagctggtattttcaacaatgctgctcaagtttggaaccat
acattctactggaattctatgaagccaaatggtggtggtaagcctactggcgcaatcgct
gctaaaattgacgaagcttttggtagctacgaaaaatttgcagaagaatttactgctgct
gcaacaactcaattcggttcaggttgggcttggttagttgctgatgaagtaaacggtaaa
ctttctattactaaaacttctaatgcagacactccacttgcacatggtcaaattgctgta
ttaacaattgacgtatgggaacacgcttactacatcgatttccgtaacttacgtcctaaa
tacatcgcaactttcttagaaagccttgtgaactgggactatgcaaacgcaaaacttgca
ggtcaaccagctggtgtagagaaataa

DBGET integrated database retrieval system