KEGG   Acinetobacter pittii: BDGL_002238Help
Entry
BDGL_002238       CDS       T01684                                 

Gene name
gatA
Definition
(RefSeq) aspartyl/glutamyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
acc  Acinetobacter pittii
Pathway
acc00970  Aminoacyl-tRNA biosynthesis
acc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BDGL_002238 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:acc03029]
    BDGL_002238 (gatA)
Enzymes [BR:acc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BDGL_002238 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BDGL_002238 (gatA)
Mitochondrial biogenesis [BR:acc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BDGL_002238 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 11636762
NCBI-ProteinID: YP_004996506
UniProt: F0KN39
LinkDB All DBs
Position
2424138..2425616
Genome map
AA seq 492 aa AA seqDB search
MTDLHRLSIRELAEGLSQAKFSSRELTEHYLKRIAKIDPLVKSYVTVTPEQALAEADAAD
AALKAGNATALTGIPLAHKDIFCTKGIKTTAGSKILDNFISPYDATVVEKTKAAGLVTLG
KVNMDEFAMGSTSESSYVGATSNPWALDHVPGGSSGGSAAAVAADLAPFATGTDTGGSIR
QPASFCGLTGLKPTYGRVSRFGIIAYASSLDQAGPMARSAEDCAYLMNVIAGHDAKDSTS
VKKEVDDYVANLNGTPVKGLRIGIPKQYFNVAGLDADVKARVEESLKKLEEMGATLVEID
LNMTEAYVPTYYLIAPAEASSNLSRYDGVRYGYRCENPADLMDLYKRSRSEGFGPEVQRR
ILIGTYALSAGYYDAYYVKAQKVRRLIQQDFLKAFENVDVIAAPAAPTTAYKIGANLSPT
EMYLGDIYTLAVNLAGLPAINAPVGFDKDSLPVGLQLIGNYWSESQLLSIVHQYQQNTDF
HTQRAAIAEENA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgactgatttacatcgcttatcaattcgtgaacttgctgagggcttaagccaagcgaag
ttttcatctcgcgaactgactgaacactatttaaaacgtattgctaaaattgacccactg
gtaaaaagttacgtgacggttacgcctgaacaagctcttgccgaagccgacgctgccgat
gctgcattaaaagcaggtaatgcaacagctttaacgggtattccacttgctcataaagat
atcttttgtaccaaaggcattaaaacaactgccggttcaaaaatactagacaacttcatc
tctccatacgacgcaactgttgttgaaaaaactaaagctgcaggtcttgtcactttaggt
aaagtgaacatggacgagtttgcaatgggttcaacttcagaaagctcgtatgttggtgca
acaagtaacccatgggcactcgaccacgttcctggtggctcatcaggtggttctgctgcg
gctgtagcggctgatttagcaccttttgctacaggtactgatacaggcggctcaattcgc
caacctgcgtcattctgcggtttaacaggcttaaaaccaacctatggtcgtgtatctcgt
ttcggcattattgcttatgcatcatctttagaccaagcgggtccaatggcacgctctgct
gaagactgtgcctacctcatgaatgtaattgcaggtcacgatgcaaaagactcaacttcg
gttaaaaaggaagttgatgactacgttgcaaatttaaatggcacacctgtaaaaggttta
cgcattggtattcctaaacagtactttaacgttgcaggcttagatgctgacgttaaagca
cgtgttgaagagtctttgaaaaagcttgaagaaatgggcgcaacgcttgttgagatcgac
ctcaacatgactgaagcttatgtaccaacgtattatctcatcgcgcctgcggaagcatct
tctaacttgtctcgttatgatggcgttcgttacggctaccgctgtgaaaaccctgctgat
ttgatggatctttataaacgttctcgttcagaaggttttggtccagaagttcagcgccgt
attctcattggtacttacgcgctttctgcgggttattacgatgcttattatgtgaaagca
caaaaagtacgtcgtttaattcaacaagacttcttaaaagcatttgaaaatgtagatgtg
attgctgctcctgctgcaccaacaactgcttataaaattggtgcaaacttaagcccaact
gaaatgtatttaggtgatatttatacacttgcagtgaacttagcaggcttaccagcgatt
aatgctcctgttggttttgataaagacagcttacctgtaggcttacaattaattggtaac
tactggtcagaatcgcaattattgtcgattgtccatcaataccaacaaaataccgatttc
catactcaacgtgcggcaattgctgaggagaatgcataa

DBGET integrated database retrieval system