KEGG   Acinetobacter pittii: BDGL_003446Help
Entry
BDGL_003446       CDS       T01684                                 

Gene name
fabI
Definition
(RefSeq) NADH-dependent enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
acc  Acinetobacter pittii
Pathway
acc00061  Fatty acid biosynthesis
acc00780  Biotin metabolism
acc01100  Metabolic pathways
acc01130  Biosynthesis of antibiotics
acc01212  Fatty acid metabolism
Module
acc_M00083  Fatty acid biosynthesis, elongation
acc_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:acc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BDGL_003446 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BDGL_003446 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BDGL_003446 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:acc01004]
    BDGL_003446 (fabI)
Enzymes [BR:acc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BDGL_003446 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BDGL_003446 (fabI)
Lipid biosynthesis proteins [BR:acc01004]
 Fatty acid synthase
  Component type
   BDGL_003446 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-GeneID: 11638115
NCBI-ProteinID: YP_004997714
UniProt: F0KMS9
LinkDB All DBs
Position
3695740..3696573
Genome map
AA seq 277 aa AA seqDB search
MLEIVLSEIGMTQGLLAGKRFLIAGVASKLSIAFGIAQALHREGAELAFTYPNEKLKKRV
DEFAEQFGSKLVFPCDVAVDAEIDNAFAELAKHWDGVDGVVHSIGFAPAHTLDGDFTDVT
DRDGFKVAHDISAYSFIAMARAAKPLLQARQGCLLTLTYQGSERVMPNYNVMGMAKASLE
AGVRYLASSLGVDGIRVNAISAGPIRTLAASGIKSFRKMLDANEKVAPLKRNVTIEEVGN
AALFLCSPWASGITGEILYVDAGFNTVGMSQSMMDDE
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaaattgttttgagtgagatcggcatgacacaaggacttttagcaggtaagcgc
tttttgattgcaggcgttgctagtaaattatcaattgcttttggtattgcacaagcatta
caccgtgaaggtgcagagcttgcgtttacttatccaaacgaaaaattaaaaaaacgtgtg
gatgaatttgctgagcaattcggttctaagcttgtgtttccatgtgatgttgctgttgat
gctgaaattgataatgcatttgcagaacttgcaaaacattgggacggcgtagatggtgtt
gtgcactcaattggctttgcacctgcacacacgcttgatggtgacttcactgacgtgact
gaccgtgacggttttaaagttgctcatgacatcagtgcatacagctttattgcaatggct
cgtgctgcaaaacctttattacaagctcgccaagggtgtttattgactttgacttaccaa
ggttctgagcgcgttatgcctaactataacgttatgggtatggcaaaagcttctttagaa
gctggtgttcgttacttggcatcaagccttggtgttgatggtattcgtgtaaacgcgatt
tctgcgggcccaatccgtactttagctgcttctggtattaaatctttccgtaaaatgtta
gatgccaatgaaaaagttgcgccattaaaacgtaacgtaaccattgaagaagtaggtaac
gcagcattattcctatgctcaccttgggcttcaggtattactggtgaaattctatatgta
gatgctggtttcaatactgtaggtatgagccaatctatgatggatgatgaataa

DBGET integrated database retrieval system