KEGG   Acinetobacter oleivorans: AOLE_01440Help
Entry
AOLE_01440        CDS       T01263                                 

Definition
(GenBank) Penicillin binding protein transpeptidase domain protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
acd  Acinetobacter oleivorans
Pathway
acd00550  Peptidoglycan biosynthesis
acd01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:acd00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AOLE_01440
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    AOLE_01440
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:acd01011]
    AOLE_01440
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:acd03036]
    AOLE_01440
Enzymes [BR:acd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AOLE_01440
Peptidoglycan biosynthesis and degradation proteins [BR:acd01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   AOLE_01440
Chromosome and associated proteins [BR:acd03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    AOLE_01440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer TMCO5
Motif
Other DBs
NCBI-ProteinID: ADI89191
UniProt: D8JM73
LinkDB All DBs
Position
317970..319802
Genome map
AA seq 610 aa AA seqDB search
MVDKRTKQTRKKQQSISEKPTLAFDMWRFYLLWAVVLLCFVVLIARAFYVQVINKDFLQN
KANANILRTERVEAMRGVISDRHGVPLAISTPIMKIVMDPRDYFDTKHLYDQITAELKKD
PNNRKLKRQLPDKNLNLDELADVVGLDRADLKKQMNARPRSRYLVLKKEIPPQQADLITK
GNFQGVYAEKTYKRYYPQPQPNAQIIGLTNSEGQGIEGLEMQLNKQLSGVDGEQKIIRDK
RGNRLKVSEVIREGEPGENITLSIDSRLQYIMYRELTAAGVANNARSATAIAVDVKTGEI
LAMTSWPSYNPNDKNGLSNKDAMRNRGAIDMFEPGSTMKPFTISSALETGQYTPNTIVNT
SPGSMRLGWHTIRDTHNYGALTVSGVIIKSSNVGSAKIALSLPKETLPSFFNRAGFGKRS
AVKFPGESSGLVLPVSKLNSSQIGTMAYGYGLNATILQLAQGYAMLANHGVKMPLSLHKL
DQAPKGEQVLAPKIADQVLLMLEQVTMPGGTAKQANIPGYRVGGKTGTAHKLRADRKGYS
NNEYRALFAGVAPISDPRLAVIVVVENPQGRYYGGLVAAPVFARIMQESLRLMNVPLDKP
LDTSVNPIRR
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atggtagataagcgaacaaaacaaacacggaaaaaacagcagtctatttcggaaaaacca
actcttgcctttgatatgtggcggttttatctgctctgggcagtagtgttactctgtttt
gttgttttaattgcacgtgcattttatgtacaagtaattaataaggattttttacaaaac
aaggccaatgccaatattttgcgtactgagcgtgtggaagctatgcgtggcgtgattagt
gaccgccatggtgtgcctttggcaattagtacaccgatcatgaaaatcgtaatggatccg
cgtgattattttgatacaaagcatttatatgaccaaattacagcggaattaaagaaagat
ccgaacaatcgtaaattaaaacgacaattacccgataaaaacttaaatcttgatgagttg
gcagatgtcgttggtttagaccgtgccgatcttaaaaagcagatgaatgctcgaccgcgt
tctcgttatctggttttgaaaaaagaaataccaccgcaacaggcagaccttattacgaaa
ggcaactttcaaggcgtgtatgccgagaaaacttataagcgctattatcctcagccccag
ccaaatgcccagattattggtttaaccaacagtgaaggccaagggattgaaggcttggaa
atgcagcttaataaacagctgtcaggtgtggatggtgagcaaaaaattattcgtgataaa
cgcggaaaccgcttaaaagtttcagaggttatccgtgagggtgagccaggcgaaaatatc
actttaagtatcgactctcgtttgcaatacattatgtatagagagctgaccgcagctggt
gttgcaaataatgcccgttcggcaactgcaattgctgtagatgttaagactggtgaaatt
cttgcaatgactagttggccgtcatataacccgaatgataaaaacggtttgtctaataaa
gatgctatgcgtaaccgcggtgcgattgatatgttcgaaccgggttcaaccatgaagcca
tttacaatttcttctgcattagaaactgggcaatatacgcctaacacgattgtaaatact
tctccaggttcaatgcgtttaggttggcatacgattcgtgatacccataactatggtgct
ttaactgttagtggcgtcattatcaaatcttcaaacgtgggttctgcaaaaattgcattg
tcgcttccaaaagaaacactaccaagcttctttaatcgtgctggttttggtaaacgctca
gctgtgaaatttccgggggaaagttcaggtttagtgcttccagtaagtaaattgaactct
tctcaaattggtaccatggcttatggttatggcctaaacgcaactattcttcagttggcg
caaggctatgcaatgcttgcaaatcatggcgtaaaaatgcctctaagcttgcataaactc
gatcaagcacctaaaggggaacaagttcttgctccaaaaattgctgatcaggttttgctt
atgttagagcaggttacgatgcctggtggtactgcaaagcaagctaatattccgggttat
cgcgttggtggtaaaacaggtacagctcataaacttcgtgcagaccgtaaaggttattca
aataatgaataccgtgctttatttgctggtgttgcgccaattagtgacccacgtttagct
gttattgtcgttgttgaaaacccacaaggccgttattacggtggtttagttgcggcccct
gtttttgcgcgcattatgcaagaatcattacgtttaatgaatgtgccgcttgataagccc
cttgatacttcagtaaatcctattcgcaggtaa

DBGET integrated database retrieval system