KEGG   Acinetobacter oleivorans: AOLE_01470Help
Entry
AOLE_01470        CDS       T01263                                 

Definition
(GenBank) putative penicillin binding protein (PonA)
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
acd  Acinetobacter oleivorans
Pathway
acd00550  Peptidoglycan biosynthesis
acd01100  Metabolic pathways
acd01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:acd00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AOLE_01470
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    AOLE_01470
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:acd01003]
    AOLE_01470
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:acd01011]
    AOLE_01470
Enzymes [BR:acd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     AOLE_01470
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AOLE_01470
Glycosyltransferases [BR:acd01003]
 Polysaccharide
  Bacterial polysaccharide
   AOLE_01470
Peptidoglycan biosynthesis and degradation proteins [BR:acd01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   AOLE_01470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: ADI89197
UniProt: D8JM79
LinkDB All DBs
Position
complement(325145..327706)
Genome map
AA seq 853 aa AA seqDB search
MKKLSSLGFVRPIFLIIIIILVSLPMGFYGMYLYIAPSLPEMSSLKKAPLLKPLQVYTSD
NQLIAEYGGKLSIPVEYKQIPPAFIHAFLAAEDSSFFEHSGISFKGLGRALSESVTGSDV
QTGGSTITMQVAKNYYLSPERTLKRKITEIFLARKIEQNLSKEEILSLYVNKIFLGKNAY
GIAAAAKIYYNKSINELSIAQMAMIAGLPKAPSKYNPVVNPERALERRNWILGRMLQLGY
ISQTEYQKAVAEPINLNMPNRDLNNIHPYAGEMVRSELVKHFGEQAIDSGYKVYTTINAK
RQAIAEKSVQDGLEAYDRRHGWRGAEAHDKPLNEFRAYANTYPAQVTKVNSSSFDALMQD
GTTVTVQWSGMSWARPYRNANSVGGAPSRASQIVQVKDIVRLRPNDAKTAWSLVQVPKVQ
GQLIAINPNDGSIEAIVGGYNFYQSKFNRALQGWRQPGSTIKPFVYALALERGMTPYSMV
NDSPITIGKWTPRNSDGRYLGMIPLRRALYLSRNTVSVRLLQTVGIERTRQLFMDFGLQE
DQIPRNYTIALGTPQVLPIQMATGYATFANGGYRVQPHFIQRIEDAYGKVIYQAKPEYAC
IPCINAPDTTDDEQKATTTDDEVIEVTNKDVEQKEKAAKQLNLKQTDKANSEYRQAQRIL
KSSSAYDMANILRDVIEHGTGRAALKIGRSDLGGKTGTTNDAKDAWFAGFNGKLVTVTWV
GFDQPTTLGRREYGGIAALPIWINFMGQALQGTPASWVRLDKDAQGPISRDKQQNVTEVG
DKKTYRAAPPLARPLYRPAPPQPKLSNDNDFSDLPGEEIVIPSKAAPPAMKPSQGAAPKR
EKDELENLINQIE
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagctatccagtttgggcttcgtgcgtccaatttttttgatcattattattatc
ttagtctcacttccgatgggcttttatggcatgtatctctatatcgccccatcgctccct
gaaatgagttcactaaaaaaagctccgcttttaaaacctctacaggtctatacctcggat
aatcaactgattgctgagtatggtggtaagctttctattccagttgaatacaaacaaatt
cctcctgcttttattcatgcatttttagcagcagaagattcttctttctttgaacatagc
gggatcagttttaaaggtttagggcgtgctttaagtgaaagtgtaactggttctgatgtg
caaactggtggttcaaccattaccatgcaggttgcaaagaactattatttaagtccagaa
agaaccttaaaacgtaaaataaccgagatctttttagctcgaaaaattgagcaaaactta
tctaaagaagaaattctcagtctgtatgtgaataaaatcttcttaggaaaaaatgcctac
ggtatcgcagcagcagccaaaatttattacaacaaaagtattaatgagctcagcattgct
caaatggcaatgattgctggtttgccgaaagcgccttctaaatacaatcctgtggttaat
cctgaacgcgcacttgaacgtcgcaactggattttaggccgtatgttacagctgggttat
atctctcaaacagaatatcaaaaagctgtagctgaaccgatcaacttaaacatgcccaat
cgggatttaaataatattcacccgtatgcaggtgaaatggttcgttcagagctggtaaaa
cattttggcgaacaagccattgattctggctataaagtctatacaaccatcaatgctaaa
cgccaagcaattgcagagaaatctgtacaagatggtcttgaagcttatgatcgtcgtcat
ggctggcgtggtgcggaagcacacgataaaccattaaatgaatttagagcatatgccaat
acctaccctgcacaagttaccaaggtaaatagcagctcttttgacgcattaatgcaagat
ggcacgaccgttactgtacagtggtcaggtatgtcatgggctcgcccctatcgcaatgcg
aatagtgtaggtggtgctccttcacgtgcatctcaaattgttcaagttaaagatattgtt
cgcttacgtccaaatgatgcaaaaacagcatggtctttagttcaggttccaaaagttcaa
ggtcaacttattgcgattaacccgaatgatggttcaattgaagcaattgtaggtggttat
aacttctatcaatcgaaatttaaccgtgccttacaaggctggcgccaacctggttcaacg
atcaaaccgtttgtctatgcattggcacttgaacgcggtatgacgccatacagcatggtg
aatgatagtcctatcacaattggtaagtggacaccgagaaactcagacggtcgttattta
gggatgatccctttacgccgtgctttgtatttgtctcgtaataccgtgtcagtacgcctt
ttgcaaacggtgggaattgaacgtactcgccagttattcatggattttggtttacaagaa
gatcaaattccacgtaactacaccattgctctaggtacacctcaagttttaccaattcaa
atggcaactggatatgcaacttttgcaaatggtggttatcgcgttcaaccacactttatt
cagcgtattgaagatgcatacggtaaagtgatttatcaagctaagccagaatatgcatgt
attccatgtattaatgcaccagacacaactgatgacgagcagaaagctacgacaacagat
gatgaagtgattgaagttactaacaaagacgtagagcagaaagaaaaggcagctaagcaa
cttaatcttaaacaaactgataaagcgaatagcgaatatcgccaagctcaacgtatttta
aaatcaagctctgcttacgatatggcgaacattttacgtgatgtaattgagcatggtaca
ggccgtgccgcacttaaaattggccgtagtgatttaggcggtaaaacaggtacaaccaac
gatgcaaaagatgcatggtttgcaggctttaacggtaaattagtgactgtaacgtgggtt
ggatttgaccaaccgacaacattaggtcgacgtgagtatggtggtattgctgcattaccg
atctggattaactttatgggtcaagcattgcaaggtacgccagcatcttgggttcgttta
gataaagatgctcaaggtcctatttcacgtgacaaacaacaaaatgttactgaagtaggc
gataagaaaacttatcgtgcagctccaccattagcacgcccgctatatcgcccagcaccg
ccacaaccaaaactaagcaatgacaatgacttttccgatttaccaggtgaggaaattgtt
attccatcaaaagctgcacctcctgcgatgaagccttcacagggagcagcaccaaagcgt
gagaaagatgaactagaaaatctgattaatcagattgaatag

DBGET integrated database retrieval system