KEGG   Acinetobacter oleivorans: AOLE_01505Help
Entry
AOLE_01505        CDS       T01263                                 

Gene name
aroB
Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
acd  Acinetobacter oleivorans
Pathway
acd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
acd01100  Metabolic pathways
acd01110  Biosynthesis of secondary metabolites
acd01130  Biosynthesis of antibiotics
acd01230  Biosynthesis of amino acids
Module
acd_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:acd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AOLE_01505 (aroB)
Enzymes [BR:acd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     AOLE_01505 (aroB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ADI89204
UniProt: D8JM86
LinkDB All DBs
Position
333689..334771
Genome map
AA seq 360 aa AA seqDB search
MQTLHVELGERRYPIFIGSQLDPKQLLEPYIHGQQVMIVSNETVAPLYLSHYQEALKSLG
KTVATCILPDGEKYKDIQHLNLIFDALLETGFNRDCTVLALGGGVIGDMAGFASACFQRG
VYFVQVPTTLLSQVDSSVGGKTGINHPLGKNMLGAFQQPQVVLADMAQLNTLPDRELSAG
LSEVIKYALLGDADFLVWLEQNMDGLIGRDADLLAEAVYRSCTHKARIVANDEKEQGERA
LLNLGHTFGHAIESYLGYGTWLHGEAVATGMVMAADLSHRLGWISNDDVERTKKIIQRAN
LPISCPKIPLDEFLGYMAHDKKVLNGQLRLVLLKQLGQAVITKDFDVELMKQAILANQHG
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactttacatgttgaattaggcgaacgccgttatcctatttttattggcagtcaa
cttgatcctaaacagttgcttgaaccttatattcatggtcaacaggtcatgattgtgagt
aacgaaacggtcgcacctttatatttatctcactatcaagaagcattaaaaagtttgggt
aaaactgtagctacgtgtattttgcccgatggtgaaaaatataaagatattcaacattta
aatttaatttttgatgcactacttgaaactggttttaaccgagattgtacggttttagct
ttaggtggtggtgtgattggtgatatggctggctttgcatctgcatgttttcagcgtggt
gtttattttgttcaggttccaactacgctcctttcacaagtagattcaagtgtaggtggt
aaaactggtattaatcatccactgggtaaaaacatgcttggcgcatttcagcaacctcaa
gttgttttggctgatatggctcaactcaacaccttaccggatcgagagttgtctgctgga
ttatcagaagtcattaaatatgccttgttaggcgacgctgattttcttgtttggttagaa
caaaatatggatgggttgattgggcgagatgctgatcttttagcagaagctgtttatcgt
tcatgtactcataaagcccgtattgttgcaaacgatgaaaaagagcaaggagaaagagcc
ttactcaacttaggtcatacgtttggtcatgctattgaatcttatctgggttatggaact
tggttgcatggcgaagcagtagctaccggcatggttatggcagctgatttatcacaccgt
ttaggctggatttcaaatgatgatgtagagcgtacaaaaaaaattattcaacgcgctaat
ttgccgatatcatgtccaaaaattccattggatgaattccttggatatatggcacatgat
aaaaaagttctcaatggtcaattacgtttagtgttgttaaagcaacttggacaagcggta
attactaaagactttgatgttgaactcatgaaacaagctattttggcaaatcaacacgga
taa

DBGET integrated database retrieval system