KEGG   Acinetobacter oleivorans: AOLE_03715Help
Entry
AOLE_03715        CDS       T01263                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
acd  Acinetobacter oleivorans
Pathway
acd00020  Citrate cycle (TCA cycle)
acd00310  Lysine degradation
acd00380  Tryptophan metabolism
acd01100  Metabolic pathways
acd01110  Biosynthesis of secondary metabolites
acd01120  Microbial metabolism in diverse environments
acd01130  Biosynthesis of antibiotics
acd01200  Carbon metabolism
Module
acd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
acd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:acd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AOLE_03715 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    AOLE_03715 (sucA)
   00380 Tryptophan metabolism
    AOLE_03715 (sucA)
Enzymes [BR:acd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     AOLE_03715 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N Lipid_DES
Motif
Other DBs
NCBI-ProteinID: ADI89642
UniProt: D8JDK5
LinkDB All DBs
Position
794550..797390
Genome map
AA seq 946 aa AA seqDB search
MQEVADALRLDTELSADSAAYIEELYEQYLSSPTSVAEDWRQYFDKYPKGDQPHGAVREQ
FLLLGRNANRVQPVVQSTVSTEHERRQIGVLQLIAAYRNRGHQKAKLDPLGLAKREDIPD
LELSAHGLTKSDLDTVFNTGNLEIGKSEATLAEMIEAMEAIYCGSIGVEYMHIVDTKEKR
WIQQRLESVRGQLNFTNDQKKGFLERLTAAEGLEKYLGNKYVGAKRFGVEGGESFIPMVN
EIIQRAGAVGCKEVVIGMPHRGRLNLLVNIMGKNPADLFGEFEGKAIHKKGSGDVKYHQG
FSSNVMTPGGEVHLALAFNPSHLEIVGPVVEGSVRARQVRRRDIGGDDVLPVIVHGDAAF
AGQGVNMETFQMSQTRGYTVGGTVHIIVNNQVGFTTSDPRDARSTEYCTDVAKMIQTPIF
HVNGDDPEAVIFATQLAHDFRHEFRKDVVLDLFCYRRRGHNEADEPSGTQPLMYQVIAKK
ATTRTLYADQLVQNKVIDRAEADQMVEDYRADLEAGNHVANALVLEPNTKMFVDWTPYLG
HDYTDDWDTSFDLNRLKELGEGMSKLPEGFVMQRQVQKVIEDRVKMQTGETALNWGAAET
LAYATLIDEDYLVRITGEDVGRGTFSHRHAKLHNQVDGSTYIPLCHVKENQPRFAIYDSL
LSEEAVLAFEYGYATTIPKSLIIWEAQFGDFVNCAQVVIDQFIASGETKWERVCGLTMLL
PHGFEGQGPEHSSARLERFLQLCAEDNMQVITPTTPAQIFHALRRQAVRPIRKPLIVMSP
KSLLRHKLATSTLEELANGSFQTVIDEIDQINKSDVTRLVLCGGKVYYDLLEKRREQNLT
NVAIVRIEQLYPYPEQRLAEILAAYPNVKELVWAQEEPKNQGAWLFIAPRLYDDILKSGK
QIRISFAGREASAAPACGSPYLHAKQQAQLINDALAIEAEQSGDSQ
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaagttgctgacgcattgcgtcttgacactgaactttccgctgatagtgcagcg
tatattgaagaactttacgagcagtacctgtcttccccaacctctgtagctgaggactgg
cgccaatatttcgataaatatccaaagggtgaccaaccacacggcgctgtgcgtgagcaa
ttcctattactaggacgtaatgctaatcgtgttcaacctgttgtacaaagtacggtaagt
actgagcatgaacgtcgtcaaattggcgttttacaacttattgctgcttatcgtaatcgc
ggacatcaaaaagctaagttagatccattaggtcttgctaagcgtgaagatattccagat
ttagagctttcagctcacggtttaaccaaatcagatctagacacagtattcaataccggt
aatcttgagatcggtaagagcgaagcgacgcttgctgaaatgattgaagcaatggaagca
atctattgtggttcaatcggtgttgaatatatgcatatcgtggacacaaaagaaaagcgt
tggattcaacaacgtcttgaaagtgttcgtggtcagcttaattttacaaatgatcaaaag
aaagggttcctggagcgtttaaccgctgcagaaggacttgaaaaatacctaggcaataaa
tacgttggtgctaaacgctttggtgtagaaggtggtgaatcttttattcctatggtgaat
gaaatcattcaacgtgctggtgctgttggttgtaaagaagttgttattggtatgccacac
cgtggccgtttaaaccttcttgttaatattatgggtaaaaaccctgcagacttgtttggc
gagtttgaaggcaaagctattcataagaaaggttctggcgacgttaaataccatcaaggt
ttctcaagtaatgtaatgactcctggtggcgaagttcacttggcattagcatttaaccca
tctcacttggaaatcgttggtcctgtagtcgaaggttctgtgcgtgcacgtcaagtgcgt
cgtagagacatcggcggtgatgatgtattacctgtgattgttcatggtgatgctgcattt
gcaggtcaaggtgtgaacatggaaaccttccagatgtcacaaactcgtggctatacggtt
ggtggtactgtacacattatcgtgaacaaccaagttggttttacaacttctgatccacgt
gatgcgcgttctactgaatattgtactgacgttgcaaaaatgattcagacgccaattttc
catgtgaatggcgatgatcctgaagcagtaatctttgctactcaattagcacatgatttc
cgtcacgaattccgtaaagacgtagtacttgacttgttctgttaccgtcgtcgtggtcat
aacgaagcagatgagccgtctggtacacaaccattgatgtatcaagtgattgctaaaaaa
gcaacaactcgtacactctatgcagatcaacttgttcaaaacaaagtaattgatcgtgct
gaagcagaccaaatggttgaagattaccgtgctgatttagaagcgggaaaccatgtggca
aatgctttagtgcttgaaccaaatacaaaaatgtttgttgattggacaccttatttgggc
catgactacacagacgattgggatacttcatttgacttaaatcgcttaaaagaattaggc
gagggcatgagcaaacttccggaaggatttgttatgcagcgtcaagtgcaaaaagtaatt
gaagatcgtgtgaaaatgcaaactggtgaaactgcattgaactggggggctgctgaaact
ttagcttacgcaaccttgatcgatgaagattaccttgttcgtattactggtgaagacgtt
gggcgtggtacattctcgcaccgtcatgcaaaattgcataatcaggtagatggctcaacg
tatattccactttgtcacgttaaagaaaaccagcctcgttttgcaatttacgattcttta
ttatctgaagaagcggttcttgcatttgaatatggttatgcaactacaattcctaagagc
ttaattatttgggaagcacaatttggtgacttcgtaaactgtgctcaggttgtaattgac
cagttcattgcttctggcgagactaagtgggaacgagtttgtggtttaacaatgttgtta
ccacacggtttcgaaggtcaaggtccagagcattcatcagctcgtttagaacgtttctta
cagttatgtgctgaagataacatgcaagtgatcactccaacgacacctgcacagattttc
catgcattacgtcgtcaagctgtacgcccaattcgtaagccattgatcgtaatgtcaccg
aaatctttacttcgtcataaacttgctacttctactttagaagagcttgcaaatggttca
ttccaaactgtaattgacgaaatcgaccaaattaacaagtcagatgtaactcgtcttgta
ctttgtggtggtaaagtttattacgacttactcgaaaaacgtcgtgaacaaaacttaact
aacgtcgcaattgtacgtattgaacagttatatccatacccagaacaacgtcttgcggaa
atcttagctgcatatccaaacgtgaaagaacttgtttgggcacaagaagagccgaagaac
caaggcgcttggttatttatcgcaccgcgtttatacgacgatatcttaaaatctggcaaa
caaatccgtatcagttttgcaggtcgtgaagcttctgctgcaccagcttgtggctcaccg
tacttgcatgcaaaacaacaagctcagctaattaatgatgcattggcaatcgaagctgaa
caatcaggagattctcaataa

DBGET integrated database retrieval system