KEGG   Acinetobacter oleivorans: AOLE_04860Help
Entry
AOLE_04860        CDS       T01263                                 

Definition
(GenBank) Linoleoyl-CoA desaturase(Delta(6)-desaturase)
  KO
K00508  linoleoyl-CoA desaturase [EC:1.14.19.3]
Organism
acd  Acinetobacter oleivorans
Pathway
acd00591  Linoleic acid metabolism
acd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    AOLE_04860
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:acd01004]
    AOLE_04860
Enzymes [BR:acd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     AOLE_04860
Lipid biosynthesis proteins [BR:acd01004]
 Desaturase
  Front-end
   AOLE_04860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: ADI89869
UniProt: D8JF03
LinkDB All DBs
Position
1066265..1067359
Genome map
AA seq 364 aa AA seqDB search
MNMPVKVEYFKNPKNRDLTPAELDAFAKELDQIKQEVLDDLGEKDAKYIRRVYAAVRYSS
FLGRACLFAGWFPPAWILGTGLLGFSKIMENMELGHNVMHGQYDWMNDPKFNGQTYEWDT
VGTSDNWRQTHNYKHHTYTNIKGIDDDIGYGLLRLFPEQRWKPGFLLQPVYSIPFCLLFQ
WGVAIQNLEIGRVLYKRKSMAKFLEELKPVNKKIGTQLFKDYVFFPLIAGPAALPVLTGN
LVANGLRNIWTFTIIFCGHFTKDAEVFPKSVLQEESRGHWYMRQIRGSSNLKGSEALHIL
SGHLSHQIEHHLYPDVPARRYRQMAPKVEAVCKKYGLNYNNASLAKQFGQVVGRIFKYAL
PFKK
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgccagtgaaagtcgaatattttaaaaatcctaaaaatcgcgatttgactcca
gcagaacttgacgcatttgcaaaagagcttgatcagatcaaacaagaagtattggatgat
ttgggtgagaaagacgctaaatatatccgccgtgtctatgcagcagttcgttacagtagt
tttctaggccgagcttgtttatttgcaggttggttcccaccagcatggattttaggaaca
ggtctattaggcttttctaaaattatggaaaacatggaacttgggcataatgtgatgcat
ggccaatacgactggatgaacgatcctaaatttaatggtcaaacctacgaatgggatacg
gtcggtacttctgataactggcgccaaacgcataactataaacatcacacatataccaac
attaaaggtatcgatgatgatattggttatggtttacttcgtttattcccagagcaacgt
tggaaacctggtttcttgcttcaacccgtttatagcattccattttgcttattgttccaa
tggggcgtagcgattcagaaccttgaaattggtcgcgttctttacaagcgtaagagcatg
gctaaattcttggaagaattgaaaccagtaaataaaaagattggtacccagcttttcaaa
gattacgtttttttcccattaattgcagggccagcggcattacctgtattgacaggaaac
ttggttgcgaatggtcttcgtaatatctggacgtttacgattattttctgtggtcacttc
acaaaagatgcagaagtatttccaaagtctgttttacaggaagaaagccgtggtcactgg
tatatgcgccagattcgtggttcttcaaatttaaaaggttcagaagcattacatatctta
agcggacatttgagccatcaaatcgagcatcatttatatcctgatgttcctgcgcgccgt
tatcgccaaatggctccaaaagttgaagctgtatgtaaaaaatatggtctaaattacaat
aatgcaagtctggctaaacagtttggacaggttgtgggtcgtatctttaaatatgcttta
ccctttaaaaaataa

DBGET integrated database retrieval system