KEGG   Acinetobacter oleivorans: AOLE_04920Help
Entry
AOLE_04920        CDS       T01263                                 

Definition
(GenBank) high-affinity phosphate ABC transporter membrane protein
  KO
K02038  phosphate transport system permease protein
Organism
acd  Acinetobacter oleivorans
Pathway
acd02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:acd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AOLE_04920
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acd02000]
    AOLE_04920
Transporters [BR:acd02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    AOLE_04920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3333 BPD_transp_1 DUF2207 YIEGIA
Motif
Other DBs
NCBI-ProteinID: ADI89881
UniProt: D8JF15
LinkDB All DBs
Position
1081370..1082767
Genome map
AA seq 465 aa AA seqDB search
MSTSNTSSPMDQNVFDPQAAAQARDRRKKVIEKSLAKRHRKEKAFRFAGLSAVVIGLAFV
ALLFSSILAKGLPAFWQTSMNVPIYFDPKVIDAGPVPVRTQGETPAHYQERYVDWQTKMG
MVDWDGIIVNGMIAKDPALASERDYLSSLYASSEAYRLRDMVFADPSLIGKKENINFLGD
ANVDVWLKGNIDRSLPDDQQQLEPEVRKLADELKAKGVLENTFNLNLFKNPDSRSSPAIS
GLAGAFMGSLFMMLIVIIIAIPIGVASAIYLEEFAPKNIVTDIIEVNINNLAAVPSIVFG
LLGAAIFIGWMHLPLSAPLVGGLVLSLMTLPTVIITTRASLKAVPPSIRQAALGLGASKF
QTIFHHVLPLALPGIMTGSIIGVAHALGETAPLLLIGMSAFVASIPATPFDQSTALPVQV
YLWQGNELRNFFEGRTAAAIIVLLALMIGLNSLAIWLRKKFEVRW
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagtacatcaaatacatcgtctcctatggatcagaacgtatttgatccacaagctgct
gctcaagcacgtgatcgccgtaaaaaagtgattgaaaagtcattggctaaacgtcaccgt
aaagaaaaagctttccgttttgctggtttatcggcagttgttattggtcttgcattcgta
gcgctattgtttagcagtattttggcaaaaggtttacctgctttttggcaaacgagcatg
aatgttccaatttacttcgatccgaaagtaattgatgcaggtccagtacctgtacgtact
caaggtgaaacacctgctcattaccaagagcgttatgtcgattggcaaactaaaatgggt
atggtggattgggatggcattattgtaaatggaatgattgccaaagatcctgcacttgct
agtgagcgtgattacttaagtagtctttatgcaagttcagaggcttatcgtttacgtgac
atggtttttgcagacccatcactcattggtaaaaaagaaaatattaatttcttgggcgat
gccaatgttgatgtctggttaaaaggtaatattgaccgttcattgccagatgatcagcaa
caacttgaaccagaagtacgtaaacttgcggatgaactaaaagcaaaaggtgttcttgaa
aatacgttcaatttgaacttgtttaagaatccggactctcgtagttcaccagcaattagt
ggtcttgctggcgcatttatgggttcattattcatgatgctgattgtgatcattattgcg
attccaattggtgttgccagcgcaatctatcttgaagaatttgctccaaagaatattgtc
acagacattattgaagttaacatcaataaccttgctgctgttccttcaattgtgtttggt
ttactcggtgcggcaatttttattggctggatgcatttacctttatcggctccgctagtc
ggtggtttagttttaagtttgatgacattaccaacagtcattattactacgcgtgcttca
ttaaaagcagtgccaccttctattcgacaagccgcacttggtttgggagcttctaagttc
cagaccattttccaccacgttttaccattagctttaccaggcattatgaccggctcaatt
attggtgttgctcatgcgcttggtgaaactgcacctttacttttaattggaatgagtgca
ttcgttgcaagtattccagcaacaccatttgatcaatcaactgcattacctgtccaagtt
tacttatggcaaggtaatgagttgcgtaacttcttcgaaggccgtactgccgctgcgatt
atcgtactacttgcactaatgattggtctaaacagtcttgcaatttggttacgtaaaaag
ttcgaagtgcgttggtaa

DBGET integrated database retrieval system