KEGG   Acinetobacter oleivorans: AOLE_04980Help
Entry
AOLE_04980        CDS       T01263                                 

Definition
(GenBank) hypothetical protein
Organism
acd  Acinetobacter oleivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OAD_gamma
Motif
Other DBs
NCBI-ProteinID: ADI89893
UniProt: D8JF27
LinkDB All DBs
Position
complement(1094630..1095046)
Genome map
AA seq 138 aa AA seqDB search
MKKSLVQSLSLVLLMSMATVGFAADKKKTAEKKTENENVVEVTPQQTITPEELAAIQVLS
EICPSLIGKKDADFAQGYERLVKDYLPNEADPVAALEKRAKDKSFKKVLKEARNDAKAAG
NEQNTLVCQDVKAYQSQN
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaagcttagttcaatcgctctctttggttttacttatgagcatggcaacagtt
ggttttgctgctgataagaagaaaacagctgaaaagaaaaccgaaaatgaaaatgttgtt
gaagtaactccacagcaaactataactcctgaagaattagctgcaattcaagtactttct
gaaatttgcccaagccttattggcaaaaaagatgctgattttgctcaaggttatgaacgt
ttagtaaaagactatttgccaaatgaagccgatccagttgcagctttagagaaacgtgct
aaagacaaaagtttcaagaaagtcctaaaagaagcgcgtaatgatgcaaaagctgctggt
aacgagcaaaacacattagtttgtcaagacgtgaaagcttatcaatcgcaaaactaa

DBGET integrated database retrieval system