KEGG   Acinetobacter oleivorans: AOLE_05210Help
Entry
AOLE_05210        CDS       T01263                                 

Definition
(GenBank) hypothetical protein
Organism
acd  Acinetobacter oleivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3015
Motif
Other DBs
NCBI-ProteinID: ADI89939
UniProt: D8JF73
LinkDB All DBs
Position
1139706..1140176
Genome map
AA seq 156 aa AA seqDB search
MLKKLALAALLAAGSSVAMADNDVGCGAGTQIWAGKKGVAPKILAATTNGIFTNQLLGIT
FGTLGCRQGGTVTAQVVTFTNENAEALARDMAVGQGESLNVLAELMQIKPQDKDRFFKVS
KANFGEIYSANNQNTLQVLASLQTVMAKDDVLKAYV
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaaaattagctttagctgctttattagcagctggttcaagtgttgcaatggct
gacaacgatgtgggttgtggtgcaggtacacaaatctgggcaggcaaaaaaggagtagcg
cctaaaattcttgctgcaacaacaaacggtatttttactaaccaattattagggatcact
ttcggtactttaggctgccgtcaaggcggaacagtaacagcgcaagttgtaacattcaca
aatgaaaatgcagaagctttagcacgtgatatggctgtaggccaaggtgaaagcctgaac
gtacttgctgagttaatgcaaatcaaacctcaagacaaagaccgtttctttaaagtttca
aaagcaaactttggtgaaatctattctgcaaataaccaaaatactcttcaagttttagca
tcactacaaactgtaatggctaaagacgacgttttaaaagcttacgtataa

DBGET integrated database retrieval system