KEGG   Acinetobacter oleivorans: AOLE_05305Help
Entry
AOLE_05305        CDS       T01263                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
acd  Acinetobacter oleivorans
Brite
Enzymes [BR:acd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AOLE_05305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ADI89958
UniProt: D8JFM7
LinkDB All DBs
Position
complement(1162464..1163090)
Genome map
AA seq 208 aa AA seqDB search
MTTITLPALPYGYDDLAPHISKETLEYHHDKHHNTYVVNLNNLIKGTDLEGKTLEEIIKA
TAGDASKAGIFNNAAQVWNHTFYWNSMKPNGGGKPTGAIAAKIEEAFGSYEKFAEEFAAA
ATTQFGSGWAWLVADEVNGKLSITKTSNADTPLAHGQIAVLTIDVWEHAYYIDFRNLRPK
YIATFLESLVNWDYANAKLAGQPAGVEK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccattactttacctgcacttccatatggctatgatgatttagcgccacatatc
agtaaagaaactttagaataccatcacgataaacaccacaatacctatgttgttaactta
aacaacttaatcaaaggaactgaccttgaaggtaaaactttagaagaaatcatcaaagca
actgctggtgatgcatctaaagctggtattttcaacaacgctgctcaagtttggaaccat
acattctactggaattctatgaagccaaatggtggtggtaaacctactggcgcaatcgct
gctaaaattgaagaagcttttggtagctacgaaaaatttgcagaagaatttgctgctgct
gcaacaactcaattcggttcaggttgggcttggttagttgctgacgaagtaaacggtaaa
ttatctattactaaaacttctaatgcagacactccacttgcacatggtcaaattgctgta
ttaacaattgacgtttgggaacatgcttactacatcgatttccgtaacttacgtcctaaa
tacatcgcaactttcttagaaagcctagtgaactgggactatgcaaatgcaaaacttgca
ggccaaccagcaggcgtagagaaataa

DBGET integrated database retrieval system