KEGG   Acinetobacter oleivorans: AOLE_05310Help
Entry
AOLE_05310        CDS       T01263                                 

Definition
(GenBank) putative hydrolase-oxidase
Organism
acd  Acinetobacter oleivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NIF3
Motif
Other DBs
NCBI-ProteinID: ADI89959
UniProt: D8JFM8
LinkDB All DBs
Position
complement(1163238..1163996)
Genome map
AA seq 252 aa AA seqDB search
MANLHEIIQWCDQTLKAAEFKDYAPNGLQIEGSTEVKRIVCAVTASEDAIDAAIAQNADL
LLVHHGYFWKGEPYPITGMRGNRIKKLIQNNISLVAYHLPLDAHPTLGNNVAIAEKLNLQ
NLEPLDLTEKHPIGNIGYLEQALSVDEFKAKLQNSFDFKVIHLPAGKQNIQKVGFCTGGA
QDFIAKAAMQNCDAYISGEVSERTFYEAKELGVHYFACGHHATERYGVQRLAQAISQQFA
IESEYFELNNPI
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatttgcatgaaattattcagtggtgcgaccaaaccttaaaagcagcagaattt
aaagattacgcaccaaatggcctgcaaattgaaggttcaactgaagtaaaacgtatcgtt
tgtgcggttactgcttccgaagatgcaattgatgcagcaattgctcaaaatgcggatcta
ttacttgtacatcatggttatttttggaaaggtgaaccgtatccaatcacaggaatgcgc
ggtaaccgcattaaaaaacttattcaaaataatatttcattagtcgcttaccatctgcca
ttagatgctcacccaactttgggcaacaatgtagccattgcagagaaattaaatttacag
aatttagaaccactcgatttaaccgagaaacatccgattggtaatattggatatttagag
caagcactttctgtggacgaatttaaagcaaaactacaaaacagttttgattttaaggtg
attcatttacccgctggaaaacaaaacattcaaaaagtaggtttctgtacaggcggcgct
caagattttattgctaaagcagctatgcaaaattgcgatgcttatatttcaggcgaagtc
agtgaacgaactttctatgaagcaaaagaattaggtgttcactattttgcttgtggtcat
catgcaactgaacgttatggagttcagcgattggcacaagcaatttcacaacagttcgct
attgaaagtgaatattttgaattgaataatccgatttaa

DBGET integrated database retrieval system