KEGG   Acinetobacter oleivorans: AOLE_05470Help
Entry
AOLE_05470        CDS       T01263                                 

Definition
(GenBank) Hypothetical ABC transporter ATP-binding protein yadG
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
acd  Acinetobacter oleivorans
Brite
KEGG Orthology (KO) [BR:acd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acd02000]
    AOLE_05470
Transporters [BR:acd02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    AOLE_05470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 DUF4162 SRP54 AAA_30 AAA_29 AAA_23
Motif
Other DBs
NCBI-ProteinID: ADI89991
UniProt: D8JFR0
LinkDB All DBs
Position
complement(1199521..1200456)
Genome map
AA seq 311 aa AA seqDB search
MTDALVLRDLSKTYRNGFQALKGINLTVPEGEFYALLGPNGAGKSTTIGIISSLTKKTSG
TVEIFGHNLDTHPSLAKQQLGVVPQEFNFGQFEKTFDILVTQAGYYGIHKKIAEKRAEHY
LEKLGLWEKRNIQARMLSGGMKRRLMIARAMMHEPKLLILDEPTAGVDIELRRSMWDFLT
EMNESGTSIILTTHYLEEAEMLCRQIAIIDRGVIKEDTSMKNFLNQLNEESFIFDLAEPI
GPLQLNIIGVKFNLIDSNTLEVTMDRAHTLNDLFQLLESQGIRVRSMRNKSNRLEELFVK
MVEKNLEGEAK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgactgatgctttggttttaagagatttgtccaaaacatatcgtaatggttttcaggcg
ttaaaaggtattaacctcactgtgcctgaaggtgaattttatgcgttgttaggcccaaat
ggtgccggcaaatcaacaaccattggtattatcagctccctcacgaaaaaaacctcagga
acagttgagatttttgggcataatctcgatacacatccatctctggcaaagcagcagctt
ggtgtcgttcctcaagaatttaactttggacagtttgaaaaaacattcgatattttagtc
actcaagctggctattacggcatccataaaaagattgcagaaaaacgtgctgaacattat
ttagaaaagctcggcctgtgggaaaaacgtaatatacaagcacgtatgctgtctggtggt
atgaagcgtcgtctaatgattgcccgtgccatgatgcatgagcctaaacttcttatttta
gatgaacctactgctggtgtagatattgaattacgccgttctatgtgggactttctgact
gaaatgaacgaaagcggtacttctattattttaacgacccactatttagaagaagcagaa
atgttgtgtcgtcaaattgcgattattgaccgcggtgtaattaaagaagataccagcatg
aagaacttccttaatcagctcaatgaagaatcatttatcttcgatttagccgaaccgatt
gggccgcttcagttaaatattattggtgtaaagtttaacttaatcgatagcaatacatta
gaagtaacgatggatagagcgcatacattaaatgacctattccagctattagaatctcaa
ggtattcgtgttcgtagtatgcgtaataaatcgaaccgtttagaagagttatttgtcaaa
atggtcgagaaaaatcttgaaggagaggcaaaatga

DBGET integrated database retrieval system