KEGG   Acinetobacter oleivorans: AOLE_13780Help
Entry
AOLE_13780        CDS       T01263                                 

Definition
(GenBank) chlorogenate esterase
Organism
acd  Acinetobacter oleivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tannase Peptidase_S9
Motif
Other DBs
NCBI-ProteinID: ADI91643
UniProt: D8JP69
LinkDB All DBs
Position
2938035..2939786
Genome map
AA seq 583 aa AA seqDB search
MNYTNNKRILTHSALVLAMLGALVGCGSDNDDTSAPSTTKPPQLSPAVGVKMTGSCSDLL
GFQYNNTVISSATLQEAGTLTVANKPIGAHCLLKGYMDQRVSPIDGQTYQIGFEMRLPID
WNGRFLYQGNGGTDGNLVPATGQVGSGGPLTNALHDGFAVISSDAGHNASQNPMFGLDPQ
ARINYGYGAITKLTPMAKNLIKTAYGKLPDRSYAGGTSNGGRHAMIAATRLGDQYDGILA
STPGFHLPRAAAAQLYTAQQLRRVATDENDLSTALTLSERKVIAKAILDRCDALDGVADG
LVQDVEACRTAFDIRQHVPVCSSTRDGTCLSAEQIDVLANIYRGPVNSAGQALYATQPFD
PGLVGSNWASWKFESSVGTARDPVAVGILFQVPPDPTVTQNSRQFAFNFNFDTDYPKLSA
TNDVYTESSMSFMMPPDELNLDKLRNHGGKMIVVQGTADGVFSVDDTQNWYDQLLQHYKN
DAKGTAPEFARFFRVPGMNHTRDGIATDQFDALTALVNWVEYGQSPDKIIATARGAGNPS
GQVNTELPQDWAPDRTRPLCPYPLIARYNGQGDSEKAENFSCK
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgaattacaccaacaataaacgaattttaacccattccgctttagtgcttgccatgctt
ggcgctttggtaggctgtggaagtgataatgatgacacatcggctccctcaacaaccaaa
ccgcctcagttgtctcctgctgtgggtgtaaaaatgacaggaagctgttcagacttactc
ggatttcaatacaacaataccgtgattagctcagccactcttcaagaggcaggcacatta
actgtagccaacaaaccaattggcgctcattgtttgctcaaaggatatatggaccaacgt
gtaagccctatcgatggacaaacttatcaaattggttttgaaatgcgcctaccaatagat
tggaacggccgttttctctatcaaggtaatggtggaaccgatggtaacttagtacctgca
acaggtcaggtcggcagcggtggtccactgaccaatgctctacatgatggttttgctgtt
atttcttccgatgcaggacataatgcttcacaaaatccaatgtttggtttagaccctcaa
gccagaattaactatggctatggcgcaattaccaaactcacgcctatggcaaaaaatcta
attaaaacagcatatggtaaattgccagatcgctcctatgcaggtggcacatcaaacggc
gggcgtcatgccatgattgctgcaacccgtttgggcgaccaatatgatggaattttggca
agtacaccgggttttcatttacctcgtgcagccgcggctcaactctacacagcgcagcag
cttcgtcgtgtcgcaacagatgaaaatgacctaagtacggctcttaccctttcagagcgt
aaagttatagcaaaagcgattttagatcgatgcgatgctttagacggtgttgcagatggc
ttggttcaagatgtcgaggcttgccgtacggcttttgatattcgccaacatgtacccgtt
tgttcaagcacaagagatggtacttgtttgagcgccgaacaaattgatgtattagccaac
atttaccgaggtcctgtaaattcggctggacaagcgctctatgcaacccagcctttcgac
cccggtttagtcggcagtaactgggcaagctggaaattcgaatcttcggtgggaacagca
cgagacccagttgcagttggaattctttttcaggttccaccagacccaactgtgactcaa
aattctagacaatttgcctttaattttaacttcgacaccgactatccaaaactatcggca
accaatgatgtatacactgaaagctccatgtcattcatgatgccgcctgatgaattgaat
ctggataaactccgtaatcatggtggaaaaatgattgtggtacaaggcacagcagacggt
gttttctctgtagatgacactcaaaattggtacgatcaactgctacaacactataaaaat
gatgcaaaaggtacagcacctgaattcgcacgtttctttagagttccgggcatgaaccat
acccgtgatggcatagcgaccgaccaatttgatgcattgactgctttagttaactgggtg
gaatatggtcaatcacctgacaaaatcattgcaactgcacgcggcgcaggtaacccgagt
ggtcaagtgaatactgaacttccacaagactgggcaccagaccgcacccgcccactttgt
ccttacccactcattgcccgctacaatggtcaaggcgatagtgaaaaggctgaaaacttt
agctgtaaataa

DBGET integrated database retrieval system