KEGG   Acinetobacter oleivorans: AOLE_15210Help
Entry
AOLE_15210        CDS       T01263                                 

Definition
(GenBank) Exonuclease sbcC
  KO
K03546  DNA repair protein SbcC/Rad50
Organism
acd  Acinetobacter oleivorans
Brite
KEGG Orthology (KO) [BR:acd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_15210
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AOLE_15210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_23 SbcCD_C AAA_29 AAA_21 ABC_tran SMC_N MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ADI91929
UniProt: D8JEP7
LinkDB All DBs
Position
3237590..3241186
Genome map
AA seq 1198 aa AA seqDB search
MKILSIRIKNLASLSDEHFIDFESSPLAHAGLIAIVGKTGAGKSTILDAMCLALFNRVPR
LKDSDGKLKDVDGSELLTNSPLTVLRRGTGHGFAELCFIAQDQKRYLARWEIKRARENPN
GKLQSVQRHLKCLTDGVVLADKAKAVDEKIKQITQLSFEQFTRAVLLAQSEVTAFLKARD
SERGELLEYLTNSSIFAKIGELAFRKTADIAKQRKQLEEFLGHIEILSDEEIAAFTEQYQ
QAEQNHHQLEQQKNVLDKQQQWFERKAKLEQEVQAKQQQFQTQQNHHQQLAGEREQLKRL
EVFSEIRQQVFQQAQNLQTLQQLEPQIQQAQTKFNELVQVFETGQKQYQLAEQELKQTLD
FEQQHQQALNQVRQSIQERAFIADEYKKCKEKRNVLEQKLSPLYQQQNTVQQHIAQLQQN
QIHLQQQLTQTQQYAVLDKGLSAHLHQLGQFIQNYQAIEQQLGNPTLARQKLSEAKSELE
QLVTSLGTVEQIELKLEQQRKDKDQKLAQITQLDLIQQKIIIYHELYAELQQFTEKQTQT
SAQEQQLKTVCQLAEQEYQTSKTEREKLQHILQQQRLLHTENIEQLRANLKDGEACLVCG
STHHPYRIDDSAVSKALFDLQQQQEQQAVALEQTKFNAWQTQQHALTQCRAELEQVQKYL
TQLKAKQSSLQQELKQQFSLNQLQIELNQAPEQILLMLNELRQAAQTAINSFDSENVRLA
QSIKQHNQLVQTIQRNESLLNTAQQWQQQVQHIVECLSETEQHAWQQASSQTAKQTWTIL
DARAKQLEQQEQLSQRFEQQQQELKMLTANFEQMAKQIDEIDQNLQEITLKGQQNNEKAV
SLIQQMTGRADIKPHEWLIEHDAKRQQQQTTYHEAKQRFEQTRQHFEQQKQALDQLKHQH
QHTSQHQQQVDGQIQNWLKAHVDFQASDLTALMQINSAQEQDIRNRLNHAERLLSEASSA
LKTMQEQLSEHLQTQPDIEHEKLVSLIQDNIAELKAQLEVRDRLKLKLEVHQQNLAKQQQ
YAEQIQNIQQEEHRWSKISGLIGDAKGKEFRDYAQQYHLDILVEHANQQLAMLSQRYTLK
RLEQSLSLAIIDHDMDGETRSVASLSGGESFLTALALSLAIANMASGSMKIESLFIDEGF
GTLDASSLHMVMNALDQLQNQGRQVILISHIQEMHERIPVQIQVKPLGAGASTIEVVG
NT seq 3597 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattttatctattcgtataaaaaatctggcatctctttctgacgagcactttatt
gattttgaaagctcgcctctagctcacgcaggcttaattgctattgtgggaaaaactggt
gctggtaaatcgaccattttagatgcgatgtgtcttgccctgtttaatcgcgttccacgt
cttaaagacagcgatggcaaattaaaagatgtcgatggctcagagctactgaccaattca
cctttaactgtattacgccgtggtacgggacatggttttgctgagctttgctttattgct
caagatcaaaaacgctatttagcacgctgggaaattaaacgtgcgcgtgaaaacccgaat
ggtaaattacaaagtgtgcaacgtcacttaaaatgcctgaccgatggtgtagtgcttgcc
gacaaagccaaagcagttgatgaaaaaattaaacaaattacccagctttcatttgaacag
tttactcgtgctgttttacttgcccagtcagaagtcacggcgtttttaaaagcacgagat
agtgaacgcggtgaactacttgagtacctgacaaactccagcattttcgccaaaattggt
gaattagcctttcgtaaaacagcagatattgcaaagcagcgtaaacagcttgaagagttc
ttaggccacattgaaattttgtctgatgaagagattgctgcatttacggaacaatatcag
caagccgagcaaaaccatcaccagttagaacaacaaaaaaatgtcttagataaacagcaa
caatggtttgagcgtaaagcaaagcttgagcaagaagttcaagctaaacaacaacagttt
caaacccagcaaaatcaccatcaacaattggctggtgagcgtgagcaattaaaacgactc
gaagttttctctgaaatacgccaacaggtttttcagcaagctcaaaatttacaaacgcta
caacagcttgaaccgcaaattcagcaagctcaaaccaagtttaatgagttggtgcaagtt
tttgaaacaggacaaaagcagtatcaacttgcagaacaagaactcaaacagacgctcgat
tttgagcagcagcatcaacaagctttaaatcaagttcgacagtccattcaagaacgcgcc
tttattgccgatgaatataaaaagtgcaaagaaaaaagaaacgtacttgagcaaaaactc
agtccactgtaccagcagcaaaatactgtgcaacagcacattgcacagcttcagcagaac
caaattcatctacaacagcagcttacccaaactcagcaatatgctgtgttggacaaaggc
ctgtcagcacatctacatcagcttgggcaatttattcaaaactaccaagcaattgaacaa
cagcttggcaaccctacccttgctcgccagaagctgtcggaagctaaaagcgaactcgaa
caactcgtaacttcactaggcacagttgaacagattgagttaaagcttgaacaacagcgt
aaagacaaagatcaaaaacttgctcaaattactcagttagatctgattcaacagaaaata
ataatttatcatgagctatatgctgagcttcagcaattcaccgaaaaacagacacagacc
tcagcccaagagcagcagcttaaaaccgtttgtcagttagctgagcaagagtaccaaaca
tcaaaaactgaacgtgaaaagttacagcacatcctgcaacagcagcgtttattacacacc
gaaaatattgagcagttacgggccaatcttaaagacggcgaagcttgcctagtgtgtggc
agcacacatcatccctatcgtattgatgacagtgcggtctctaaagctttattcgacttg
cagcaacaacaagagcaacaggcagtagcgctagaacaaactaaatttaacgcatggcaa
acccagcaacatgcacttactcagtgccgtgccgagcttgagcaagttcagaaatactta
actcaacttaaagccaaacaatcaagcttgcagcaagagcttaagcagcagtttagtctc
aatcagttacagattgagctaaatcaagctcctgaacaaatcttgctaatgctgaacgaa
ctcagacaagcggcacaaactgccataaattcatttgactcagaaaacgtgcgtttagcc
caatcgattaaacaacacaatcagcttgttcaaacgattcaacgtaatgaaagtttgctt
aatacagcacagcaatggcaacaacaagttcaacatattgttgagtgcttatcggaaact
gaacagcacgcatggcagcaagcaagtagccaaacggctaagcagacttggactattctt
gatgcacgcgctaagcagcttgagcaacaagaacagctttcacagcgttttgaacagcag
caacaagaacttaaaatgttgactgctaactttgaacaaatggccaagcaaattgatgag
atcgatcaaaatctccaagagattacgcttaaaggccaacaaaataatgaaaaagcggtg
tcgctcattcaacaaatgactggccgcgctgacattaaaccgcacgaatggttaattgaa
cacgatgctaaacgtcagcaacaacaaactacctatcatgaggctaaacaacgtttcgaa
caaaccagacagcactttgaacagcaaaaacaggcgctcgatcagctcaagcatcaacat
caacacacctcgcaacatcagcagcaggttgatggacaaattcaaaactggttaaaagct
cacgttgattttcaggcatctgatcttacggcactcatgcagattaattccgcccaagag
caagacattcgtaaccgtcttaatcatgccgagcgtttattaagtgaagcctcttctgcc
cttaaaaccatgcaagagcaattgagcgagcatttacaaactcagccagatattgaacat
gaaaagcttgttagccttattcaagacaatattgcagagctcaaagcacagcttgaagta
cgtgatcggcttaaacttaagcttgaagtacatcagcaaaacctagctaagcagcaacaa
tacgccgagcagattcaaaatattcagcaagaagagcatcgttggagcaaaatttcaggt
ctgattggcgatgctaaaggtaaagagttccgtgactatgctcagcaatatcacctagat
attttagttgaacatgcgaatcaacaactggcgatgctttctcaacgttatacgctaaaa
cgcctagagcaatcgttaagccttgcgattattgaccacgatatggatggagaaacccgc
tccgttgcatctttatctggcggtgaatcattcttaactgcccttgccttgtctttagcc
attgccaatatggcctcaggttcaatgaaaattgaatctctatttattgatgaaggcttt
ggtactttggatgcttcttctttgcacatggtcatgaatgctttagatcaattgcaaaat
cagggtcgtcaggtcattctcatttcacacattcaagaaatgcatgagcgtattcctgta
caaattcaagtgaaaccacttggtgctggtgcaagtacgattgaagtcgtgggttaa

DBGET integrated database retrieval system