KEGG   Acinetobacter oleivorans: AOLE_18845Help
Entry
AOLE_18845        CDS       T01263                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
acd  Acinetobacter oleivorans
Pathway
acd00473  D-Alanine metabolism
acd01100  Metabolic pathways
acd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:acd00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AOLE_18845
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AOLE_18845
Enzymes [BR:acd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AOLE_18845
Peptidoglycan biosynthesis and degradation proteins [BR:acd01011]
 Precursor biosynthesis
  Racemase
   AOLE_18845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADI92651
UniProt: D8JJ28
LinkDB All DBs
Position
complement(4016998..4018101)
Genome map
AA seq 367 aa AA seqDB search
MPRPITAVIHRQALQNNLAVVRKTMPNSKVFAVVKANAYGHGIERVYEAFKAADGFALLD
LDEAKRIRALGWTGPILLLEGIFSPQDLFDCVQYQLSFTIHSEAQIEWVEKHPYPAQFNV
CLKMNSGMNRLGFKPQNYVQAWERLNNLANVSKITHMMHFSDADGDRFGQQGIDYQITAF
EEIIKDLPGERSVSNSAAILRYQDQLKSDYARSGIMLYGSSPDYPTHSIADWGLQPTMSL
RSEIISVQHLEPNESVGYGSNFVAEQPITIGIVACGYADGYQRISPTGTPVLVDSVRTRT
IGRVSMDMLAVDLTGIESAKVGSEVVLWGQSSTGVVLPIDDVAVSSGTVGYELMCAVTVR
VQFINQV
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtcctattaccgcagtgatccaccgtcaagccttacaaaataacttggcggtg
gtacgcaagactatgccaaacagtaaggtctttgccgttgtaaaagccaatgcttatgga
cacggaattgaacgtgtttatgaagcatttaaagcagcagatggctttgccttacttgat
cttgatgaagcaaaacgcattcgtgctttaggttggacaggtccaattttattgctcgaa
gggattttttctcctcaagatttatttgattgtgtgcagtatcaactcagtttcaccatt
catagtgaagcgcaaattgagtgggtagaaaagcatccttatccagcccaatttaatgtt
tgtctaaaaatgaacagtggtatgaaccgtcttggttttaaaccacaaaactatgttcag
gcttgggaacgtttaaataacttggcaaatgtgtccaagattacgcacatgatgcatttt
tctgatgcagatggtgatcgtttcggccagcaaggcattgattatcaaatcactgcattt
gaagaaattattaaagatttaccgggtgaaagatctgtaagtaatagcgcagcaattctg
cgttatcaagaccagctcaaatcagattatgcacgtagcggcatcatgctctatggcagc
tcgccagactacccgacgcatagtattgcggattggggcttacaaccgaccatgagctta
cgcagcgaaattatttcagttcagcatttagaaccgaatgaaagcgtaggttatggctca
aactttgtcgcagagcagcccataacgattgggattgtcgcttgtggctatgccgatggt
tatcagcgtatttcaccaacaggtacgcctgttttagtggactctgtccgcactcgtaca
attggccgcgtcagcatggatatgttggcagtcgatttaacaggtattgaaagtgccaaa
gtcggcagtgaagtcgtgctttggggccaatcaagtacaggcgtcgttttacctattgat
gatgtcgcagtttcatccggtacggtgggctatgaactgatgtgtgctgtcaccgtccgt
gttcaatttattaatcaggtataa

DBGET integrated database retrieval system