KEGG   Acidothermus cellulolyticus: Acel_0388Help
Entry
Acel_0388         CDS       T00426                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP)
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ace  Acidothermus cellulolyticus
Pathway
ace00020  Citrate cycle (TCA cycle)
ace00480  Glutathione metabolism
ace01100  Metabolic pathways
ace01110  Biosynthesis of secondary metabolites
ace01120  Microbial metabolism in diverse environments
ace01130  Biosynthesis of antibiotics
ace01200  Carbon metabolism
ace01210  2-Oxocarboxylic acid metabolism
ace01230  Biosynthesis of amino acids
Module
ace_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ace00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Acel_0388
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Acel_0388
Enzymes [BR:ace01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Acel_0388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: ABK52162
UniProt: A0LRV2
LinkDB All DBs
Position
401308..402531
Genome map
AA seq 407 aa AA seqDB search
MPKIKVANPIVELDGDEMTRVIWRMIKEQLLFPYLDIPLLYFDLGIENRDATDDQVTIDA
AYAIKEHGVGVKCATITPDEARVAEFGLKKMWKSPNGTIRNILGGVIFREPIIISNIPRL
VPSWTKPIVIGRHAHGDQYRATDFVVPGPGRVTLTYTPADGGAPVEFEVAEFSGGGVALG
MYNYDESIRDFARACFRYGLDRGYPVYLSTKNTILKAYDGRFKDIFAEVFAQEFETAFKE
AGLSYEHRLIDDMVASALKWEGGYVWACKNYDGDVQSDAVAQGFGSLGLMTSVLMTPDGR
TVEAEAAHGTVTRHFRLHQQGKPTSTNPIASIYAWTRGLEHRGKLDGTPEVVRFARTLEE
VCVRTVESGKMTKDLAMLVGPETPWLTTEEFLAALAENLQAALAASS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagattaaagtcgccaatccgatcgtcgaacttgacggcgatgagatgacacgg
gtcatctggcgcatgatcaaagagcagttgttgtttccctatctcgatattccgctgcta
tatttcgatctgggcattgagaatcgcgacgcgaccgacgatcaggtgaccatcgacgcc
gcgtacgccatcaaggagcacggcgtcggcgtcaagtgtgcgacaatcacgccggacgag
gcccgggtcgccgaattcgggctgaaaaagatgtggaagtcgccgaacggcacgatccgt
aacatcctcgggggcgtgattttccgcgagccaatcattatctcgaacattccacggttg
gtgccgagctggacgaagccgattgtcatcggacgtcacgcgcacggcgaccagtaccgc
gcgaccgatttcgtcgtgcccggcccgggtcgggtcaccctcacctacaccccagcggac
ggcggtgccccggtcgagttcgaggtggcggaattctccggcggtggcgtcgctctcggc
atgtacaactacgacgagtcgatccgcgatttcgcccgggcctgtttccggtacggcctc
gaccgcggatatcccgtctatctctccacgaagaacacgattctcaaggcctacgacggg
cggttcaaggacattttcgccgaggtcttcgcccaggaattcgagacggcgttcaaagaa
gccgggctcagctacgagcatcggctgatcgacgacatggtggccagcgcgctgaaatgg
gaaggcggctacgtctgggcgtgcaagaactatgacggcgacgtgcaatccgacgccgtc
gcgcaaggcttcggttcccttggcctcatgacctcggtgctgatgacgccggacggccgg
acggtcgaggcggaggcggcgcacggcacggtgacccgtcatttccgtctgcaccagcaa
gggaaaccgacatcgaccaatcccatcgcctcgatttacgcctggacccgcggtctggag
catcgcgggaaactggacggcaccccggaggtggtccggttcgcgcgcacgctcgaagag
gtgtgcgtgcggacggtcgagagcgggaagatgaccaaggacctcgcgatgctggtcggg
ccggagaccccgtggctcaccaccgaagaattcctcgctgcccttgcggagaatctccag
gctgcgctcgcggcgtcgtcctga

DBGET integrated database retrieval system