KEGG   Acidothermus cellulolyticus: Acel_0566Help
Entry
Acel_0566         CDS       T00426                                 

Definition
(GenBank) Superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
ace  Acidothermus cellulolyticus
Brite
KEGG Orthology (KO) [BR:ace00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Acel_0566
Enzymes [BR:ace01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Acel_0566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni Phage_clamp_A DUF2937
Motif
Other DBs
NCBI-ProteinID: ABK52339
UniProt: A0LSC9
LinkDB All DBs
Position
complement(597389..597796)
Genome map
AA seq 135 aa AA seqDB search
MKVLARLLTPRTTVHAHCDLPCGVYDPAQARIEAESVKAIMEKYQANDDPAFRARALFIK
EQRAELVKHHLWVLWTDYFKPNHLEKYPQLHQLFWEATKLAGAAGAKGQQDPAVAQQLLD
KIAEIDKIFWETKQG
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtactcgctcgccttctcaccccccgcacaaccgtccatgcgcactgtgatctg
ccgtgcggggtctacgatcctgcccaggcccgcatcgaagcggaatccgtcaaggccatc
atggagaaataccaagccaacgacgaccccgccttccgagcccgggctctgttcatcaag
gaacaacgtgctgagcttgtgaaacaccacctgtgggtgctctggacggattacttcaag
cccaaccacttggagaagtacccacagctccaccaactgttctgggaggccaccaagctc
gccggcgccgccggggcgaaaggtcagcaagacccggctgtcgcccagcagctcctggac
aaaatcgccgagattgacaagatcttctgggagaccaagcagggctga

DBGET integrated database retrieval system