KEGG   Acidothermus cellulolyticus: Acel_1376Help
Entry
Acel_1376         CDS       T00426                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
ace  Acidothermus cellulolyticus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ABK53148
UniProt: A0LUN8
LinkDB All DBs
Position
1534459..1535541
Genome map
AA seq 360 aa AA seqDB search
MNLPVSPPVEPMLARLAPSIPPGMHYEPKWDGFRCIIFRDGDEVVFGSRTGRPLERYFPE
LADGARRELPARCVIDGEIVVLTDGRVDFGTLQQRIHPAASRIRALADASPAVVVVFDLL
ATADTAMLTRTFHERRARLVELLAGSGFPFLLTPATDDHARAAYWFAALEGAGLDGIVAK
PFDLRYQPGKRVMVKIKHERTADCVVAGMRPYRGGSGVGSLLLGLYDDAGVLQYVGVCGA
FAASSRTALATELSPLVTEITDHPWGAGHGRVPGTPNRWNSGENLDWVPLRPERVCEVAY
DFLDGARFRHTAQFRRWRPDRTPESCRFDQFEAPEPIDLAAALDLPPADRCRPRPQPAGP
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcttccggtctcaccgccggtcgagccgatgctcgcccgccttgccccgagcatt
ccaccgggcatgcattacgaaccgaaatgggacggctttcggtgcatcattttccgggac
ggcgacgaggtggtgttcggcagccgtaccggccgacccctggagcgatattttcccgag
ctcgcggacggcgcacgccgggaattgccggcccgatgcgtcattgacggggaaatcgtc
gtcctgaccgacggccgggtcgatttcggcacgctgcaacaacgcatccatccggcggct
tcccgaatccgggcgctcgccgatgcctcccccgcggtcgtcgtcgtcttcgacttgctc
gcgacagctgatacggcgatgctcacgcggacctttcatgagcggcgggcccggctcgtg
gagctccttgccggcagcgggtttcccttcctgctcactccggccactgacgaccacgcc
cgggcggcgtactggttcgccgcgctggaaggcgccggccttgacggcatcgtcgccaaa
cccttcgacctgcgttaccagccggggaaacgggtgatggtgaaaatcaaacacgagcga
accgccgactgcgtggtcgccggcatgcggccgtatcgcggcggcagtggtgtcgggtcg
ctcctgctcgggctgtatgacgacgccggggtcctgcagtacgtgggggtctgcggcgca
ttcgccgcctcctcccggacggcactcgccacggaactgtcgccgctggtcaccgagatc
accgatcacccctggggagcagggcacggccgggtaccgggtacgccgaatcgatggaac
tccggagagaacctggactgggttccgctgcggccggagcgggtctgtgaggtggcctac
gactttctggacggcgcccggttccgtcacaccgcgcagtttcggcgctggcggccggac
cggaccccggaatcctgccgtttcgaccaattcgaggcgcccgaaccgatcgacctcgcc
gcggccctcgatctcccgcctgcagaccgatgccggccgcggccccagccggctgggcca
tag

DBGET integrated database retrieval system