KEGG   Acidothermus cellulolyticus: Acel_1450Help
Entry
Acel_1450         CDS       T00426                                 

Definition
(GenBank) efflux transporter, RND family, MFP subunit
  KO
K02005  HlyD family secretion protein
Organism
ace  Acidothermus cellulolyticus
Brite
KEGG Orthology (KO) [BR:ace00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    Acel_1450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biotin_lipoyl_2 HlyD_3 HlyD_D23 Biotin_lipoyl Peptidase_M23 DMSP_lyase
Motif
Other DBs
NCBI-ProteinID: ABK53222
UniProt: A0LUW2
LinkDB All DBs
Position
1619632..1621500
Genome map
AA seq 622 aa AA seqDB search
MRWTRFGAINFVLALAAAAGGGIAYASLGMPAASSANTPVRTTTVAMGTVMSTISATGNV
TAPNDIAVNFATSGKLTEIDVTVGERVTQGQVLARLDATQAKANLAAAQAQLASAQAKLA
ELEQGPTALQQQGYQLANQQAQAQVTQANQQLANANQALQFDEQNLAAAVTKAQQQLQQA
QAQLAADQQKYTTDSQSLAQAVDQARNQAAQQLGIDQAQLNADTLQLQNDTAKEQTDCQA
SSPACPADQLAVARDQVAVANDQAKVAADGSPTDDYSEATVVQNALQNEQATLAKDQQTI
TSDQQAVSNASDAVAAAQTAEQQGIAKDKQAIAAAQQQVANAQLNAQITENSNAQKTAPP
LASDVDSAEAAVEQAQSQVDTAQQALDATTLTAPADGTIGAINGSVGETISGGNTASITA
STANSSSSGSAVAAFITLTNLTNLQVVANIDEADAAKIHTGSPATVTLNALPGKEFSAHV
LEVADTATVANNVVEYQVTFSLDQSDPAVKPGMTANVTVVTAEADGVLNVASAAVRSAGG
DSYVMVVGPNGTERRVDVVVGLKGDTTTEISGPLQAGDVVALPTVTRTTTSSTSTTTRVP
GLGGGFGVGGGFGGFGGGGGRG
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgcgctggacgagattcggtgcgatcaactttgtcttggctctcgcagccgccgccggt
ggcggaattgcgtatgcgtcgctcggcatgccggcggcgtccagtgccaataccccggtg
cgcaccacgacggttgccatgggcacggtcatgtcgaccatctcggcgaccggcaacgtc
acggcaccgaatgacatcgcggtgaacttcgcgacaagtggcaagctcacggaaatcgac
gtcaccgtcggcgagagggtgacgcagggacaagttctcgcccgcctggacgccacacag
gccaaggcaaatctcgccgccgcccaagctcagctcgcctcggcgcaagcaaaactcgcc
gaactggaacagggccccactgcgctgcagcaacagggctatcaactggcgaaccaacag
gcccaagcgcaggtcacccaggcgaatcagcagcttgccaacgccaaccaggccctgcaa
ttcgacgagcagaatctcgcagcagccgtcaccaaggcgcagcaacaactgcagcaagcg
caggcgcaactcgcggctgaccagcagaagtacacgaccgacagtcagagcctcgcccaa
gccgtcgaccaggcgcgcaatcaagctgcccagcaactcggaatcgaccaggcacaactc
aacgccgacaccttgcagctccagaacgacaccgcgaaggagcagacggattgccaagca
tcctcccccgcctgcccagccgatcagctcgccgtcgcgcgggaccaggtagcggtcgcc
aacgatcaagccaaagtggcggcggacggctcaccgacggacgattactcagaggccacg
gtcgtgcagaacgccctccagaacgaacaagcgaccctggccaaggaccagcagacaatc
accagcgatcagcaagcggtcagcaacgcgagcgacgcagtcgccgctgcgcagaccgcc
gaacagcaaggcatcgcaaaggacaagcaagccattgcagccgctcagcagcaggtggcg
aacgcgcagctcaacgcgcaaatcaccgagaacagcaacgctcagaagactgcgccgccg
ctcgcgtcggacgtcgacagcgccgaagctgccgtggaacaagcacaatctcaggtcgac
accgctcagcaggcgctcgacgcgacaacgctcaccgcgccggccgacggcacgatcgga
gccatcaacgggtcggtgggtgagacgatcagcggcggcaacacggccagcattaccgcc
tccacggcgaacagcagctccagcggctcggccgtcgctgccttcatcaccttgaccaac
ctgacgaatcttcaggtcgtcgcgaatatcgatgaagcggacgccgcgaagattcacacc
ggctccccggcgaccgtgacgctcaacgccctgccgggcaaagaattttcggcgcacgtg
ctcgaagtcgccgacacggcgaccgtcgccaacaacgtcgtggagtatcaggtcactttc
tccctagatcaatcggatcccgcggtgaaacccggaatgaccgccaatgtcaccgtggtc
accgccgaggcggacggcgtcctcaacgtcgcgtcagcggcggtgcgcagtgcgggtggc
gattcctacgtcatggtcgtcgggccgaacggcacggagcgtcgagtggacgtcgtcgtc
ggcttgaagggtgataccacaacggaaatctccggtccgcttcaggctggtgacgtcgtc
gccctgcctaccgtcacgcggaccacgacaagctcgacgtcgacgacgacgcgtgtcccg
gggctcgggggcggcttcggagtcggtggcggtttcggcggcttcggcgggggcggaggc
cgaggatga

DBGET integrated database retrieval system