KEGG   Acidothermus cellulolyticus: Acel_1670Help
Entry
Acel_1670         CDS       T00426                                 

Definition
(GenBank) DNA primase-like protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ace  Acidothermus cellulolyticus
Brite
KEGG Orthology (KO) [BR:ace00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Acel_1670
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ace03400]
    Acel_1670
Enzymes [BR:ace01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Acel_1670
DNA repair and recombination proteins [BR:ace03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Acel_1670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N
Motif
Other DBs
NCBI-ProteinID: ABK53442
UniProt: A0LVI2
LinkDB All DBs
Position
1878389..1879972
Genome map
AA seq 527 aa AA seqDB search
MADRRPGDLREYRRRRNFCRTPEPAGRADPRHITRNSAEPRFVVQRHRATRLHYDLRLEI
NGVLVSWAVPKGPTLDPTVRRAAIHVEDHPLEYLDFEGAIPHGEYGGGDVIVWDTGTWRP
HGTDDPAQAVVDGELHADFFGRKLRGRFVFVRRGTDEKSWLVLHKDDEHAVRGWNPEDYP
RSVLSGATNDDVARHPRRLWRGGRAHPVAQHNDTEASADEIAALDALDDEGTWEVFGRRL
KVTHLNKVIYPGRGRTHALTKRDLLRYAARIAPVVMPYLAGRPFTMHRFPDGIDAPGFWH
KQLPSHAPDWLPRWQNPSAKRGEAATYLVVDEPAALIWAVNFGAIEWHAWTSRTDRPDLP
TWALVDIDPGSRTTWRELVELALLHRDALDHLGVQGKPKLTGQRGIQIWIPIRRGPTFDD
TRAWVEHLSKVVGSLMPDAVSWEWEKKRRAGRARLDFTQNAANKTLVAPYSPRPLPRAPV
SAPVEWDELPHLRPDRFTVRTILDRLAERGDPFHALLTVNQQLPPLG
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggccgacagacgaccgggagacctgcgcgaataccggcgcagacggaatttctgccgc
acccccgaaccggcaggacgcgcggacccccggcacattacccgcaattcagcagaaccg
cggtttgtggtacagcgacatcgcgcaacgcggctgcattatgaccttcgactggaaatc
aacggggtcctggtgagctgggccgtgccgaaggggccgaccctggatcccacggtgcgg
cgagcggcgatccacgtcgaggatcatccgctggaatatctggactttgaaggtgcgatt
ccccacggggagtacggcggcggcgacgtcattgtgtgggacaccggcacgtggcgtcca
cacggcaccgacgatccggcacaagcggtcgtggacggcgaactccatgccgatttcttc
ggccgcaaactccgtgggcggttcgtcttcgtccgccgcggcaccgatgaaaaatcctgg
cttgtgctgcacaaggacgacgagcacgccgtccggggttggaatccggaggattacccg
cgctccgtcctctccggagccacaaacgacgacgtcgcccgacatccgcgccgactgtgg
agaggaggccgtgcgcatccggtggctcagcacaacgacaccgaagcgagtgccgacgaa
atcgcggcactcgacgcgctcgacgatgagggcacgtgggaggtcttcggcaggcgcctc
aaggtgacccatctcaacaaggtgatctacccgggacgcggacgcacccacgcactcacc
aaacgcgatctcctccgctacgcggcgcgcattgcacccgtcgtcatgccgtacctagcc
ggccgcccgttcaccatgcatcgcttccccgacggcatcgacgcacccggtttctggcac
aaacaattgccgtcacacgctcctgactggttgccgcggtggcaaaatccgagcgctaaa
cgcggagaagcagcgacgtaccttgttgtggacgaaccagcggccttgatctgggcggtc
aattttggtgcgatcgagtggcacgcctggacctcacgcacggaccggccagacctgccg
acctgggcattggtggacatcgacccggggagccgcacgacgtggcgggagctcgtcgag
ctggccctccttcaccgcgacgctctcgaccaccttggtgtgcagggaaaacctaagctc
accggtcaacgcggcatccagatatggattccgatccggcgcggcccgacatttgacgac
acaagagcctgggtcgagcacttgtccaaggtggtcggctccctcatgcccgatgccgtg
agttgggagtgggagaagaagcggcgcgccggtcgggcccgcttggatttcacacagaac
gcggcgaacaagacgcttgtcgctccatacagcccgcgtccattgccgcgggcccccgtc
tcggctccggtcgagtgggacgaactcccgcacctgcgcccggatcgctttaccgtgcgc
actattctcgaccgtcttgcagagcgtggagacccattccacgcgctgctcaccgttaac
caacagctcccgccgctcggctaa

DBGET integrated database retrieval system