KEGG   Acidothermus cellulolyticus: Acel_1705Help
Entry
Acel_1705         CDS       T00426                                 

Definition
(GenBank) CobB/CobQ domain protein glutamine amidotransferase
  KO
K07009  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Organism
ace  Acidothermus cellulolyticus
Pathway
ace00550  Peptidoglycan biosynthesis
ace01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ace00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Acel_1705
Enzymes [BR:ace01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.13  lipid II isoglutaminyl synthase (glutamine-hydrolysing)
     Acel_1705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 GATase
Motif
Other DBs
NCBI-ProteinID: ABK53477
UniProt: A0LVL7
LinkDB All DBs
Position
complement(1918615..1919433)
Genome map
AA seq 272 aa AA seqDB search
MSAADRLRPEDAGRVHPRDPQSRDPQSQDPLPRDPLRIVSIFPTLLGTYGDGGNARILAV
RAQARGIAAEVLVIDPGTPLPVDGDIYLLGGGEDDAQVAAARLLRADGGLARAADRGAVI
FGVCAGYQLLGHAFPGAGGEIESGLGLLDVTTSRLTRRAVGELLAEPTDATPLQTFLTGY
ENHAGATVIGAGARPLGQVRHGVGNGTLFAGKPAEGAVQGRIIGTYLHGPGLARNPDLAD
LLLSMAVGTPLPPWPQPEIEALRAERLASLRG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcggctgaccggctgagaccagaagacgctggtcgcgtgcacccccgagacccg
caatctcgagacccgcaatctcaagacccgctgccccgagatccgctgcgcattgtgtcg
atttttccgaccctgcttggcacctacggcgacggcggaaacgcccggattctcgcggtg
cgcgcgcaggctcggggcatcgccgccgaggtgctcgtcatcgatcccggaacgccgctc
ccggttgacggcgacatttacctcctcggcggcggcgaggacgacgcccaggtcgcggct
gctcgactgctccgcgcggacggcggcctggcgcgcgccgctgaccgtggagcggtgatc
ttcggggtctgcgcggggtatcagctgctcggccacgcattccccggcgccggcggggag
atcgagagcggccttggattgctggacgtgacgacgtcccggttgacccgccgcgcggtc
ggtgagctgcttgctgaaccgaccgacgctacgccgctccaaacgttcctgaccggttac
gagaaccacgccggggcgaccgtgatcggcgccggtgctcggccgcttgggcaggtgcgg
catggcgtcgggaacgggacgctgttcgccggaaagccggcggaaggcgcggtccagggc
cggatcatcggaacgtatctgcacgggccgggactggcgcgcaatccggacctcgccgac
ctgctgctgagcatggcggtcggtacgccgctgccgccctggccgcaaccggagattgag
gcattgcgcgccgaacggctcgcgtcactgcgcggatag

DBGET integrated database retrieval system