KEGG   Atta cephalotes (leaf cutting ant): 105617422Help
Entry
105617422         CDS       T04923                                 

Definition
(RefSeq) uncharacterized protein LOC105617422
  KO
K11459  polycomb group RING finger protein 4
Organism
acep  Atta cephalotes (leaf cutting ant)
Brite
KEGG Orthology (KO) [BR:acep00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:acep03036]
    105617422
Chromosome and associated proteins [BR:acep03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     105617422
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_5 zf-rbx1 Prok-RING_4 zf-C3HC4_4 zf-RING_6 zf-RING_UBOX zf-Nse
Motif
Other DBs
NCBI-GeneID: 105617422
NCBI-ProteinID: XP_012054367
UniProt: A0A158NA09
LinkDB All DBs
Position
Unknown
AA seq 1447 aa AA seqDB search
MSGQSGGQRVCLARLNEHLTCKLCDGYFIDATTIIECLHSFCKSCIVKYLESNKYCPICE
VQVHKSRPLLNIRPDHILQDIVYKLVPGCYQNEMRRRREFYAKHPEESIQTISAEARGKP
IESYIYSPDESLSLSLEYSDPRTKDLSETNTEKSILRRYFRCPAAVTIFHLQKLIRAKYG
LGDVNRVDIMYEEEPLCSSYSLMDVMYIYHWRRKVPLHLSYRIFETSSKRLKLSEDNANY
KKSLMDAGIDSIEIKDEKSLKREWKEVQLKISETGVMSITDISNTVHKRDIETLQDEKIP
EETITSIAEINKVDSVIETCGIPKSVEIMQSTLIIDPELTKNPIFSDPNDAFLVTSDVKF
TNENLPTKNCTPLTTNQHNGTATKQANETKNCTASTKSQQDAQEVKVQNQTVNVEDKFET
VSQEQKVIDQSQQSTQFTEKKVIEIKDKEKIDAHAEKMSINNNNNSADFQTESQKECIKN
SSETKMVSAGSKIDALSAKLQFQPKVGQVNNTYSKKAPKEKRAMLQQGTKKSDVKSSTEN
TKLTDAKAQTNCENVTSKVSVSVATSSQKSVMSTTVASQNISDSLSVSDKQKVLDEKNNQ
SISIDLQQALNLLEQRNSPVLASSESAPRTNHTAGMINQRLPNNIVTMNEDIVSTVPNIS
TATISQTTSTFPYVSLHDIVTNSAVLKSALKNSSSIPQKPLGTSPIACSTSNNQISPMSQ
FNMQASPMNMYSIPTSLKNNYSNVSQDVTTVTVASTATITTTAMSKPISTGVCPIPPCPD
AIPISLMKQISMRKQDMAAKGTNLNEICAKIGSNTIGSKINDICAKIGENSKEKNRVDAH
NKSEVPDLLRISAKKNSSPLLPNSDTALKHIPNIPNVPVYTPSSNATMENKNTKPALPTS
TSANMLGMSTSSVPASSHANQRLAPLKKQNQSIGYKTLRDPPKSWNPTLSKNNYVAAKNQ
AKEMQNQTQTSMSESTNKQIPSKPAKIFKMRNMPRYLGNPASGVKPMYGVVSDTKEKDQS
TTNTKGATLNMMKIDPKTLSPIVSTINSPIVSPPLYSPNARSYQNTPFSRDICRNTGSPI
SPRNSPVNMLSTNPFIPSPTPNTNPRIIYSHFPSPFPDASRFPNPLIRSPIGIPPPSAFH
SSLPPSINKLYQRSSYIPQTTGYAPVVGQPPTVQRIPPSTHSSSPKSPKASSPSSISSTF
NLGKAESQSPITSTVDNVALLLSKNVAVPVSVSLQRELNAFNLSKTGGLSQSPTSNVVKT
SSTMDTNDANVETQLAKPNSSSLNLVAVTANAEVFDKSSSPSSANERKQGKETEARKVQE
TTRYKEDNSKVKLTEAKCSEVVDNIANLHDKKEKNQAAKINGDVTIEQFASKKSKEADNN
DEKKTTAEKIELDGQERSSPKERNSIPKINTANINDSSDGSKNEDLNKSGEQIQGNKSEV
QKNKAET
NT seq 4344 nt NT seq  +upstreamnt  +downstreamnt
atgtcagggcagagtggtggacaacgagtgtgtttggccagacttaatgaacacttgaca
tgcaaattatgtgatggatattttatcgatgcgactactattatagaatgtttacactcg
ttttgcaaaagttgcattgttaaatatttggaaagtaacaagtattgtccaatctgtgaa
gtacaggttcacaaaagtaggccactattaaatatacgtcctgatcatatattacaggat
attgtttataaactggtacctggatgttatcaaaacgaaatgcgacgtcggagagaattt
tatgcaaaacatccagaagaatctattcaaacaatatctgctgaagctcgtggaaaacct
atagaatcatacatatattctccggatgaatctctcagcttgtctctggaatactctgat
cctcgtacaaaagatttaagtgagacgaatactgaaaaatccattttaaggcgatatttt
cgatgtcctgcagcagtcacaatattccatttacaaaaactgataagagccaaatatggc
cttggtgatgtaaatagagttgatataatgtacgaagaagaaccattatgcagtagttat
tcattaatggatgtaatgtatatctatcattggaggcggaaagtaccattgcacttaagt
tatagaatatttgaaacatcttcaaaacgtttgaaattatcggaagataatgcaaactat
aaaaaatcattaatggatgctggtattgattctatagaaataaaggatgagaaatcgtta
aaacgcgagtggaaagaagtgcaattaaaaatatcggaaacaggagtaatgagtataact
gatatatcgaatacagtacataaaagagacatcgagactttacaagatgaaaaaattcca
gaagagactataacctccattgcggaaattaataaagtagattcagtgatagaaacttgt
ggtattcctaaatctgtagaaataatgcaatctactttaatcattgatccagaattaacg
aaaaatccaatattttctgatccgaatgatgcattccttgttacgagtgacgttaagttt
acaaatgagaatttaccgactaagaattgtacgccactgacaaccaatcagcacaatgga
actgctacaaagcaggcaaatgaaacaaaaaattgcaccgcttctacaaaatcgcaacaa
gatgcacaagaagtaaaagtccaaaatcaaactgttaatgtcgaagacaaatttgagaca
gtttcacaagagcaaaaggttattgatcaatcgcaacaatcaacacaatttacagagaag
aaagtaattgaaattaaagataaagaaaagatagacgcacatgcggaaaagatgtcaata
aataataacaacaatagtgcggattttcagactgaatctcagaaggaatgcattaaaaat
tcaagtgaaacaaaaatggtaagtgctggatcaaaaattgatgcattgagcgcgaaatta
caatttcaaccaaaagtaggtcaagttaataacacttattccaagaaagcgccaaaggaa
aaacgagcgatgcttcagcaaggtacgaaaaaatccgatgtaaaatcatcaaccgaaaat
acaaaacttactgatgcgaaagcgcaaacaaattgtgagaatgtaacgagtaaagtatca
gtttcggtggcaacttcttcacaaaaatcggttatgtctactacggtggcatctcaaaat
atttcagattccttgtcagtatctgataaacaaaaagttctcgacgagaagaataatcaa
agtataagtattgatttgcaacaagctttgaatttgttggaacagagaaactcgcctgta
ctagcatcgtcagagtctgctccgagaacgaatcacaccgccggtatgatcaatcagaga
ctaccgaacaatattgtcacgatgaatgaggatattgtgtctactgtaccaaacatttct
acagccacgattagtcagacaacatcaacatttccctacgtttcgcttcacgacattgta
actaactcagccgtcctaaaatcagcattaaagaattccagtagcatacctcagaaaccg
ttaggaacatcgcccattgcttgttcaacatccaacaaccaaatatcaccgatgtctcaa
tttaacatgcaagcgtcacccatgaatatgtattctatacctacgtcgctaaagaataat
tacagtaacgtaagtcaagatgtaactactgttacggttgcatccacagcaacgatcact
acgacggcgatgtcaaaaccaatatcgactggtgtgtgtccgatacctccatgtccggat
gcaatccctatatctctgatgaaacaaatatctatgcgtaagcaggacatggccgcaaag
ggtaccaatctgaatgaaatttgcgcaaaaattggttccaatacgatcggctcgaagatc
aatgatatctgtgcaaagataggagaaaattcaaaggagaagaacagagtagatgcgcat
aataagtcggaagtgccagatctgcttagaataagcgcgaagaagaattcttcgccatta
ttacccaattcagatacagcgttgaagcatataccgaatatcccgaatgtaccagtgtac
actccaagtagcaatgcaacaatggagaataaaaacaccaagcctgccttacctacgtct
acatctgccaatatgctgggaatgtcaacatcttcggtaccggcatcgtctcacgcaaac
cagagattagcgcctcttaagaagcagaatcaatcgattggatacaaaacgttacgcgat
ccacctaaatcttggaaccctacattgtcgaaaaataattacgtagcggcaaagaatcag
gcgaaggagatgcaaaatcaaactcagacttctatgtccgagagtacaaacaagcagatc
ccatctaaaccggctaagatcttcaaaatgcgaaacatgccacgatacttgggtaatccc
gcatcaggtgtgaagcccatgtatggggtcgtaagcgatacgaaggagaaagatcaatcg
acaaccaacacgaagggtgctactctcaatatgatgaagatcgatcctaagactttatcg
cccattgtctcgacaattaattcaccaatcgtttcaccaccactttattcgccgaacgct
cgaagctatcagaataccccgttctcacgggatatatgtcgaaacactggctcacctata
tcgccaagaaattctccggtaaatatgttgtcgaccaatccattcataccatctcccacg
cccaacactaatcctcgaatcatatattctcactttccgtctccattcccagacgcaagc
cgatttccgaatcctttgatacgatcgcctatcggcattccgcctcctagtgccttccac
agtagtctaccgccttcgatcaacaagctgtatcagcgatcgagttatataccgcaaact
actggttacgcgccagtggttggccaaccgccgacggtacagagaataccacccagcaca
cattcatcttcgccaaagtcgcccaaagcctcgtcgccgagttcgatctcgtctacattt
aaccttgggaaggcggaatcacaatcgccgatcacatcaacggtggacaatgtcgcgcta
cttctctctaagaacgtagccgtaccagtgtctgtgtcactgcaacgagaacttaacgcg
ttcaatctatccaaaactggcggtttgtcacaaagtccgacgtccaacgttgttaaaaca
tcgtccacgatggacacaaatgatgccaacgttgagacacagctcgctaaaccgaattct
tcttcgctcaacttggtggcggttacagcaaacgccgaagtattcgataaatcgagttcg
ccaagcagcgctaatgaacgaaaacaaggtaaggaaacggaggcacgaaaagtgcaggaa
accacgcgatataaagaagacaactccaaggtgaaacttacggaagcaaaatgcagtgaa
gttgttgacaacattgcgaatctgcacgacaaaaaggagaagaatcaagcggccaaaatc
aatggtgatgttacaatagaacaattcgcaagtaagaaatctaaggaagctgataataac
gacgagaagaagacaacagcagagaagattgagctagatggccaagaacggtcttcgccc
aaagaacggaatagtattccgaagattaatacagccaatatcaatgactcgtcagatggt
tccaagaacgaagatctcaacaagagcggtgagcagatacagggtaataaatctgaagta
caaaaaaataaggcagagacgtga

DBGET integrated database retrieval system