KEGG   Atta cephalotes (leaf cutting ant): 105618452Help
Entry
105618452         CDS       T04923                                 

Definition
(RefSeq) DNA polymerase zeta catalytic subunit
  KO
K02350  DNA polymerase zeta [EC:2.7.7.7]
Organism
acep  Atta cephalotes (leaf cutting ant)
Pathway
acep03460  Fanconi anemia pathway
Module
acep_M00293  DNA polymerase zeta complex
Brite
KEGG Orthology (KO) [BR:acep00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    105618452
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acep03400]
    105618452
Enzymes [BR:acep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     105618452
DNA repair and recombination proteins [BR:acep03400]
 Eukaryotic Type
  TLS (translesion DNA synthesis) factors
   B-family DNA polymerases
    105618452
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 zf-C4pol
Motif
Other DBs
NCBI-GeneID: 105618452
NCBI-ProteinID: XP_012055379
UniProt: A0A158NCX1
LinkDB All DBs
Position
Unknown
AA seq 1942 aa AA seqDB search
MFSITLVNIDSYQSSPIPELDVTFSEFRGSEVKKVPVIRAFGSTATGKKTCLHIHGVFPY
LYVPCTVQENMDSYAYQLAAAIDSALNTSFGSTLSTNQHVYKIQRVSGIPFYGYHEKEHL
FFKIYFYNPTIIKRTADLLQNGVVLNQTLQPYEAHIPYILQFMIDYNLYGMNLINLNSVK
YRHSLQGCATEDSQSRSSMDFLDSEAYLPISITRQSMCELEVDVHASEILNRQNVNEKLE
LNPGLAAIWNEEKARRAEVDLENAKSQLLYPKTPSKIILPPTSNDIYQKDQLLKRLNAIS
QINETITSNTTIPSYPIEIEDNENILNASHILNHSESLVSEENLERTINNCKLLQLASSA
FLDATRSQSNMTDTSFLDADDIQLVDMLADLAEKNEIASNVDDDSVLGSQYSMFNEQIKD
PEEEEIEDLNITSFDLDLSSWESVYNQKSNQHDNIIKVVDNKQNIGSADDSNVTEENNGV
TLVNFPQVDGVDDLYEIVSKHEETSNSLINFTISNVDGATADSSDAESEVDVTIEKQEKR
VCTYKSDKKSVPQNIVQITPKKRKFDSQDDDHESSKKRRNVAKTPKRKYNSPSKMSRSPQ
LSGNYSPLNITITSPKSSKDPIRQCESPKRNQYVSISDIPSTSATPKHKKRPLRVSLLRE
KFFNSEDHQKGMESNEKSFIKMNKEVRKRLSFLDEDYNEEDTFVESDCNKNQSETLIALG
HSSNQVHAEATTFISSNANSDDSVPNSQCTEKNINDVSPERNYASDIQNLAKKFIKTHSV
IPETDLDDDEEDVCNITFTQHLNQKIGSDSQSSLSEQRARRSSKNAIITITTKYKPPCPG
RILESMTMYGIPKCRSQKPFFGNKLDLAKQKESLNTNASYFDEPMFKSSLEEITSIKLWR
RMKVNEFYPSGANIKSYHIKRTLAGYNSLTIKPLMEPPSSKNVKDWIRAKKYISKQNSDA
KSCKQNKEKALNVQNVQHPLINNATNEEINPQPGTFNNLISNDSNMERHIDSLMPQQSIL
NRTSNETRKLETQNSSDSLISEKTLDPSLKKVLANPLLHKQETQLGVSYGQIEYSSKGSY
GSNVSNENLQKARAVTVHQYLTLLSLEVHTVTREDLLPDPQYDAIAALFYAIYNDAPTNA
TTNEQIEHAAIIVNSNCISARLNKIHSASARCPILYVATEQDAFNSLVKLIERHNPDILL
GWEVEALSWGYVFQRAFHLGLNNFPLRISRVPHMQIYSKFDAHAVEKDDIGDIKVSGRNL
LDVWRIMRHEAALLTYTFENVMHHILHERVPCPSFKMLSTWWKQESMIIKSRVIHHYIVR
VVGTLKLLGHLDVIGRTCELARLFGIQFYEVFSRGSQFRVESMMLRLAKPMNYIPISPSM
HQRAKMRAPECLPLIMEPESKFYIDPLIVLDFQSLYPSMIIAYNYCFSTCLGRIEHIGQY
GPFEFGAATLRVRKNTVLKLQDKINFSPCGVAFVKKEVRQGILPRMLSEILNTRLMVKES
MKLYPAENRTLQRVLHSQQLGLKLIANVTYGYTSANFSGRMPCIEIGDSVVSKGRETLER
AIKLVETTPRWGARVVYGDTDSLFILLPGKSREEAFTIGEEIADAVTATNPPPVKLKFEK
VLHPSILQTKKRYCGYMYETRDQEKPEFLAKGIETVRRDGCPAVSKILEKTLKILFETKD
VSLVKQYVIRQFDKIFQRRVSILDLTFAKEFRGMRGYKANACVPALELTRRLIKKDPRAI
PRTSERVRYVIVAGAPNQALIHCVRTPMEVVADPSLILNSVYYITKVIIPPLNRCFNLFR
IDVNAWYKEISHHSNFNNIAHLRGDNPKSTIRQFFSSASCIICEEQTNKEICPDCLLQPS
RTVLVLLEKIKQLERNHQQITAICHSCIGRLSNIECVSLDCPVLYRMAQARKELAQVSYL
NNIIYGNNSSGIKELNTVTEWY
NT seq 5829 nt NT seq  +upstreamnt  +downstreamnt
atgttttccatcactttggtgaatattgatagttatcagtcatccccgatacccgagctg
gatgtgacattttcagaattccgtggctccgaagtaaaaaaagtaccggtaatcagagca
ttcggctcaactgccacaggaaagaaaacatgcttgcatattcacggtgtttttccatac
ctatatgtcccatgcactgtccaagagaatatggatagctatgcttatcaactggctgca
gcaattgattctgcactcaatacatcttttggttccactttatctaccaatcaacatgtg
tacaaaattcaacgagtatcaggaatacctttctatggttatcatgagaaagaacatttg
ttttttaaaatatatttttataatccaaccataattaaaaggacggcagatttgttgcag
aatggtgttgttctcaatcaaactctgcagccatatgaggcacacattccgtatatttta
caatttatgatagattacaatctctatggcatgaatttaatcaatttaaatagcgtaaaa
tacagacactctttgcaaggatgtgcaacagaagatagtcaaagcagatcgtcaatggat
tttctagattcagaagcatatcttccgatatcaataacaagacaaagcatgtgtgagttg
gaagtggatgtgcacgcttcagagattctgaataggcaaaatgtcaatgaaaaattagaa
ctgaatcctggtcttgctgcgatttggaatgaagagaaagcaaggagggccgaagttgat
ctagaaaatgcaaagtcgcaattattatatcccaaaactccgagcaaaattattttaccg
ccaactagcaatgatatttatcaaaaggatcaattattaaaaagactgaatgctatatca
caaatcaacgagacaattacttcaaatacaacgataccttcatatcctattgaaatagaa
gataatgaaaatatcttaaatgcatctcatattttaaatcatagcgaatctcttgtatct
gaagaaaatcttgaaagaacaattaataattgtaaattgttgcaattggcatcatcagcg
tttttagacgcaactcgaagtcaaagtaatatgacagatactagttttttggatgcagat
gatatacaattggtagatatgctagctgatttagcagaaaaaaatgagattgcgagtaat
gtagatgatgatagcgttctagggtctcaatattctatgttcaatgaacagattaaggat
ccagaagaagaagaaattgaggatttaaatatcacaagttttgatctagatctaagttct
tgggaatcagtgtataatcagaaatccaatcaacatgacaatataataaaagttgtagat
aataagcagaacattggatctgcagatgattcaaacgttactgaagaaaataacggtgtc
acgctcgtgaattttccacaagttgatggagttgatgatttatatgagatcgtatcaaaa
catgaagaaacttcaaatagtttaataaactttacaatatcgaatgtcgatggggctaca
gctgactcgagcgatgctgaatccgaagttgatgtgacaattgaaaaacaagaaaaacgc
gtgtgcacttataagtccgataaaaagagcgtaccacaaaatatagttcagattactccg
aaaaaaaggaaatttgattctcaagacgacgatcacgagtcatccaaaaaacgaagaaac
gtggctaaaacgccaaaaagaaaatataattctccaagcaagatgtctcgaagtccacag
ttgtcaggaaattactcgcctcttaatattactattacatctccgaaatctagtaaagat
cctattcgacaatgtgaatctccaaaaagaaatcaatacgtatcaatatctgatattcct
tcaacttctgctacaccaaaacacaaaaaacgtccattacgtgtgagcttgcttcgtgaa
aaattttttaattcggaagatcatcaaaagggaatggaaagcaatgaaaaatcatttatt
aaaatgaataaagaggttcgaaaaagattgtccttcttggatgaagattataatgaagaa
gatacttttgtagaatcagattgtaacaagaatcaatctgaaactttaatcgcacttggg
cattcgagtaatcaagtacatgcagaggcaactacatttatctccagcaatgcaaatagt
gatgatagtgtcccaaacagtcaatgtacagaaaaaaatattaatgatgtatctcccgaa
agaaactatgcgtcagacatacaaaacttggcaaagaagtttataaaaactcatagtgtt
attcctgaaactgatctagacgacgatgaagaagatgtatgtaacataactttcactcaa
catctcaatcaaaagatagggagtgacagtcaaagttcgttgtcagagcagagggctcgt
cgttcatcgaaaaatgcaataattacaattactacgaaatacaagcctccttgtcctgga
aggattctggaaagtatgacgatgtacggcattcctaaatgtagatcacaaaaaccattt
ttcggcaacaaactcgatcttgcgaaacagaaagaatccttgaatactaacgcttcatat
ttcgacgaacccatgtttaaatctagtctagaagaaatcacgagtattaaactgtggcga
agaatgaaagtcaatgaattttatccgtctggagcgaatataaaatcttatcatatcaaa
cggacgcttgcaggatataattcgttaacgattaaaccacttatggaaccaccatcttct
aagaatgttaaagattggattagagctaaaaaatacatatcgaaacaaaattctgatgcc
aaatcgtgtaagcagaataaagaaaaggcattaaatgtacaaaatgtacagcatccattg
attaataatgccactaacgaagagattaatccccagccagggacgtttaataatttaatc
agtaatgattcaaacatggagcgtcatatagattcactaatgcctcaacaaagcattctg
aatagaacatctaacgaaaccaggaaattagagacacaaaattctagtgattcattgata
tcggaaaaaactttagatccttccttaaaaaaagtactggcaaatccattattacataaa
caggagacgcagctaggtgtttcgtacggtcaaattgaatattcatctaaaggaagctat
ggaagtaatgtctcgaacgaaaatcttcaaaaagctagagcagtaacagtacatcagtat
ttaacgttattatctctcgaagtgcatactgttactcgagaagatcttctccctgatccg
cagtatgatgctattgctgcattattttacgcaatttacaatgacgctccaacaaatgct
acgacaaatgaacaaatagaacatgccgctataattgtaaattctaactgtataagtgca
agactcaacaagatccattctgctagtgcgaggtgtccaattttatatgttgcaacggaa
caggatgcatttaacagccttgtaaaattgattgagcggcacaatccagacattctactt
ggctgggaagtagaggctctttcatggggctacgtttttcaacgagcatttcatcttggt
ctcaataactttccattgagaatctcgagggttccacacatgcaaatatattccaaattc
gatgctcacgcggttgaaaaggacgatataggtgatataaaagtatctggtcgcaatctc
ctcgatgtctggaggattatgagacatgaagcagcattattgacgtacacttttgagaac
gtcatgcatcacattttacatgaaagagttccgtgtccttccttcaagatgttgtccact
tggtggaaacaggagagcatgataataaaaagcagagttatacatcattatatcgtcaga
gttgtgggtactctcaagcttctaggtcatttggatgttataggtcgcacgtgtgaactc
gcccgacttttcggtatacaattttatgaagttttctcgcgaggctcacaatttcgcgtg
gagtctatgatgctcagattagcgaaacccatgaattacattccgatctcgccatccatg
caccagagagctaagatgcgagctccagaatgtctgccattgatcatggaacccgagtct
aaattttatatcgatccattgattgtgcttgatttccaaagtttatatccgagtatgatc
attgcttataactattgtttctccacctgtttagggagaatagaacacataggccaatac
gggccattcgagtttggtgcagcaacattaagagtaagaaagaatacagtattaaagttg
caagacaaaataaacttttcgccttgcggcgtggcctttgtaaagaaagaggtacgtcaa
ggaatattaccgcgtatgctttcggaaattttgaatacgcgtctgatggtgaaggaatct
atgaagctgtatccggcagaaaatcgtacattgcaacgcgttcttcattctcagcaattg
ggtctcaagttaattgcaaacgttacttatggctatacatccgccaattttagcggtaga
atgccgtgcattgagataggtgatagtgtagttagcaaagggcgagagacattggaacgt
gcgatcaaattggtggaaaccacaccaagatggggcgcacgagtagtttatggagataca
gattctttatttatactattacctggaaaatctcgagaagaggcctttactatcggcgag
gaaatcgcagacgctgttaccgcaactaatcccccgcccgtgaaacttaaatttgagaaa
gttctccatccatctattttgcaaacgaaaaaacgatattgtggatatatgtatgaaact
cgcgatcaagagaagcccgagttcctggctaaagggatcgagacggttcgcagagatgga
tgtcccgcagtttctaaaatacttgaaaaaaccctcaaaattttgttcgaaacgaaagac
gtctccctggtgaagcagtatgtaatcaggcaatttgacaaaatctttcagcggcgcgta
tccatcctggatcttacattcgcgaaagaatttcgtggaatgcgcggatacaaagccaac
gcttgcgtgccagcattggagttaacacgcaggttgattaaaaaggatcctcgcgctata
ccgcgcaccagcgagcgtgttcgttatgtcatcgtcgcaggtgcaccaaatcaagcgctc
attcactgcgtgcgcacgccgatggaagtcgtcgccgatccgtcgttaattctaaactct
gtgtattacataacgaaagtcatcataccgcccctcaatcgctgctttaatttattccga
atcgatgttaatgcgtggtataaagaaatctcccatcattcgaatttcaataatatcgca
cacttaagaggagacaatccaaagtccactattcgtcagttcttcagttccgcgtcgtgc
attatctgtgaggaacagaccaataaagagatttgtccagattgccttttacagccaagc
cgaaccgttctcgtacttctcgaaaagataaaacagttagaaaggaatcatcaacaaatt
actgccatctgtcattcctgcattggacgattgagtaacatagaatgcgtgtctttggac
tgtcctgttttataccgaatggcacaagctcgtaaagagcttgcgcaagtttcctatcta
aataatattatttatggaaataattccagtggaatcaaggaattaaatacagttactgaa
tggtattga

DBGET integrated database retrieval system