KEGG   Atta cephalotes (leaf cutting ant): 105618535Help
Entry
105618535         CDS       T04923                                 

Definition
(RefSeq) armadillo segment polarity protein
  KO
K02105  catenin beta 1
Organism
acep  Atta cephalotes (leaf cutting ant)
Pathway
acep04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:acep00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105618535
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm Adaptin_N HEAT_2 Cnd1 KAP Arm_2 DUF3361 V-ATPase_H_N RIX1 DUF1877 Atx10homo_assoc
Motif
Other DBs
NCBI-GeneID: 105618535
NCBI-ProteinID: XP_012055457
UniProt: A0A158ND49
LinkDB All DBs
Position
Unknown
AA seq 810 aa AA seqDB search
MSYPMSTNQSRPMSQGNYQGPGDLPMGSAKEQTLMWQQNSYMNDSGIHSGAVTQAPSLSG
KEDEEMEGDQLMFDLDQGFAQGFTQDQVDEMNQQLSHTRSQRVRAAMFPETLEEGVEIPS
TQFDPAQPTAVQRLAEPSQMLKHAVVNLINYQDDADLATRAIPELIKLLNDEDQVVVSQA
AMMVHQLSKKEASRHAIMNSMQMVAALVRAISNSEDLESTKAAVGTLHNLSHHRQGLLAI
FKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVALLQRNNV
KFLAIVTDCLQILAYGNQESKLIILASQGPIELVRIMRSYEYEKLLWTTSRVLKVLSVCP
SNKPAIVEAGGMQALAMHLANPSQRLVQNCLWTLRNLSDAGTKVDGLDNLLQSLVLVLGS
ADVNVVTCAAGILSNLTCNNQRNKVAVCNFGGVDALVRTIINAGDREEITEPAVCALRHL
TSRHGEAEMAQNSVRINYGIQVIVKLLHPPSRWPLVKAVIGLIRNLALCPSNHIPLRDHG
AIHHLVRLLMRAFQDTQRQRSSVASTGSQQTSGAYADGVRMEEIVEGSVGALHILARESN
NRMIIRSQNVIPIFVQLLFNEIENIQRVAAGVLCELAADKEGAEIIEQEGATAPLTELLH
SRNEGVATYAAAVLFRMSEDKPQEYKKRLSMELTNSLFREDTNLWNNADFSMAPDLQDML
GPEQGYDGMYGQGPPSVHSSHGGRGYQPQGYDQIPVDSMQGLEIGGGSTYGAMDTMDVAH
DGDLSFDHLEELPAPPQDNNQVAAWYDTDL
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgagttacccaatgtcaacgaatcaatctagaccgatgtctcaaggaaattatcagggc
ccgggcgacttgcctatgggctctgctaaggaacagacactcatgtggcagcagaattcc
tacatgaatgactcaggtattcattccggcgctgtcactcaggcaccatctctatctggc
aaggaagatgaagagatggaaggggatcagctgatgttcgatctggatcaagggtttgca
cagggttttacacaagatcaagttgatgaaatgaatcagcaactgagtcacactcgatca
cagcgtgtgcgtgctgctatgtttcctgaaacattagaggaaggtgtagagataccttcc
acgcaatttgatcccgcacagcctaccgctgtacagagattagccgagccgagtcaaatg
ctgaaacatgccgttgtcaatttgataaattatcaagatgatgctgatcttgctacgcgc
gctattccagaattgatcaaattgttgaacgatgaggatcaggtggttgtttctcaagcg
gccatgatggtacatcaactgtctaagaaggaagcctctcgtcatgctattatgaacagc
atgcagatggtagccgccttagtacgagctatctctaacagcgaggatttagaatcgacg
aaggctgcagtcggcaccttgcacaatttatcacatcatcgacaaggcttgctagctatt
ttcaagagcggcggaatccctgcgcttgtaaaactactgagttccccagtagagtctgtt
ctcttttacgcaataacgacgctacataacttattgcttcaccaagacggctctaaaatg
gccgtgcgccttgccggtggtttgcaaaaaatggttgctctacttcaacggaataatgtt
aaatttctagctattgttactgattgtctgcagattctggcatatggaaatcaagagagt
aagctgattattcttgcttcgcaaggcccgatagagcttgtgcgcatcatgcgctcttac
gaatatgagaaattgttgtggaccacttcgagagtattgaaagtattgtctgtttgtcct
agtaataaacctgcgattgtggaggctggtggtatgcaggcactcgccatgcatcttgca
aatccgagtcaaagattagtgcagaattgtttgtggacattgcgtaatctatcagacgct
ggcacaaaggttgacggacttgataacttgttgcagagtctcgtgcttgtgctcggatca
gcagacgtgaatgtggttacgtgcgctgctggcattttgtcaaacttgacctgtaataat
cagcgtaacaaagttgcagtatgtaattttggcggtgtcgatgctctggttcgtacgatc
atcaatgccggtgatcgggaggaaataaccgaaccagcggtgtgcgccttacgtcacttg
acctcgcgtcacggcgaagcggaaatggcacaaaattccgttcgaataaattatggtatt
caagttatagtcaaattacttcatccgccatcgcgctggccattggtgaaagcggttatt
ggattaatccgcaacttggctctttgtccttctaatcacatcccgttacgcgaccacggt
gcaatacatcatcttgtgagactcttgatgcgtgcattccaggatactcaacgacaacga
tcatctgttgctagtaccggaagtcaacaaacatcaggtgcatatgcagatggagtacga
atggaagaaatagtagaaggttcagtaggtgctcttcatattcttgcaagagagtccaat
aataggatgataattcgatcgcagaacgtaattccgattttcgtacaactattattcaac
gagattgaaaatattcaacgtgtggcagccggtgtactttgcgaactggcagctgacaaa
gaaggcgccgaaataatagaacaggagggtgcaaccgccccgctgacagagctgctacac
tccaggaatgagggtgtggctacttacgcagcggcagtgctattccgcatgagcgaagat
aagccccaagagtacaaaaaacgactttccatggagctgacgaattccttattccgtgaa
gatacaaatctgtggaacaatgccgacttcagcatggctccggatcttcaggacatgctt
ggccctgaacaaggctatgatggtatgtatggccaaggacctcctagcgtacacagcagc
catggcggtcggggttatcaaccgcaaggttatgaccagataccagtagattcgatgcaa
gggttagagataggtggtggatcgacatatggcgcaatggacactatggacgtggcgcat
gatggtgacttgagtttcgatcacttggaagagcttcctgcaccgccgcaagataacaac
caagtcgcagcctggtacgacaccgatctctga

DBGET integrated database retrieval system