KEGG   Atta cephalotes (leaf cutting ant): 105618896Help
Entry
105618896         CDS       T04923                                 

Definition
(RefSeq) alpha-glucosidase-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
acep  Atta cephalotes (leaf cutting ant)
Pathway
acep00052  Galactose metabolism
acep00500  Starch and sucrose metabolism
acep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105618896
   00500 Starch and sucrose metabolism
    105618896
Enzymes [BR:acep01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     105618896
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 105618896
NCBI-ProteinID: XP_012055847
UniProt: A0A158NE89
LinkDB All DBs
Position
Unknown
AA seq 577 aa AA seqDB search
MIRSCILTAALIVLAGSNAVQEADKDWYKNSLVYQIYPRSFKDSNGDGIGDLNGITDELE
HIKDIGADALWMSPIFSSPQKDFGYDISNFTNINEEYGTLDDFRKLVQKAQSLGLKVILD
FVPNHSSDQHEWFNKSIQGIKPYDEYYVWHDAKSENNIKKPPNNWLSAFGGSAWEWNEIR
GQYYLHQFAVGQPDLNYRNSKLREEMQNVLVFWMDLGVKGFRIDAINHLYENDQFLDEPL
SNLDVPSNDYDYLNHIYTKNLPETYDVLKTWRELMNNHSTGDAKMILTEAYADFDLTIKY
YQSGSTVPFNFVFVSDLNNKSSAADFKHNIDRWINNMPKGAEYVANWVTGNHDNHRAASR
FGEKRADQLSMLATVLPGISVIYNGDEIGMLDRNFTYNETVDPAGCGAGEERYFLKSRDP
ERTPFQWDNSISAGFSSNESTWLPVNKNYKSLNLKAQKSELYSHYNVFKRLTQLKKKPVI
EQGTLETALYCYKCSVAENVLGIVRRNETSIVVLIVNFNDTETVTVDISTWLNISEQLMV
YTSSEGSNLLLRSPVNMVTFSLSGSVSVVLVTEDLFD
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgattcgttcatgtattctcaccgcggcgttgatcgttctggccggctcgaatgcggtc
caggaagcggataaggattggtataaaaacagtctggtatatcagatctatccaagaagc
ttcaaggacagtaatggcgatggcattggcgatttgaatggtatcacggacgagttagaa
cacattaaggacattggcgccgatgcgttatggatgtcaccgatcttttctagtccacag
aaagatttcggctatgatatttctaattttaccaatatcaatgaagaatacggcacctta
gatgattttagaaaactcgtacagaaagcacaatcccttggattgaaagtaatccttgat
ttcgtgccgaatcacagctctgatcaacacgaatggtttaacaaaagtatccaaggtatt
aaaccctatgacgaatattatgtatggcatgacgcaaaatctgaaaataacattaagaaa
ccaccgaataactggttgagtgcttttggaggctctgcctgggaatggaacgaaatacga
gggcagtattatctgcatcagttcgctgttggacagccagatctcaattatcgtaatagt
aagttgcgagaagaaatgcaaaacgtgttggtattctggatggatctgggcgtaaaaggt
ttccgcattgacgctatcaatcatttgtatgagaatgatcaattcttggatgaaccatta
agtaacttagacgtaccaagcaatgattacgactacttgaatcacatttacacaaaaaat
cttcccgaaacttacgacgttctcaagacttggagagagttgatgaacaatcactcgacg
ggtgacgcgaaaatgatcttgaccgaggcctatgcggactttgatctcactataaagtat
tatcaatctggttcaacggtaccattcaacttcgtgttcgttagtgatttaaataacaag
tccagcgcggccgatttcaaacataatatcgatcgttggataaacaacatgcctaaaggt
gcggaatatgttgcgaattgggtgacgggaaatcatgacaatcatcgcgcggctagcaga
ttcggggagaaacgggccgatcaactttccatgttggcaaccgttttgcccggtataagc
gtgatttataatggcgacgagatcggtatgctcgatagaaattttacatacaacgaaact
gtggatcctgccggatgcggagctggagaggaaagatattttctaaaatcgcgagatcca
gaaagaacacctttccaatgggataatagcatcagcgccggtttctctagcaacgaatca
acgtggcttccggtgaacaagaattataaatccttgaatttaaaggcgcaaaaatctgag
ctctactctcattataacgtgtttaaacgcttaacacaactgaagaagaagcccgtcatc
gagcagggcactctggagactgcgttatattgttacaaatgttctgtcgctgaaaatgtt
ctagggatagtacgacgaaatgaaacatctatcgtggtcctcatagtgaacttcaacgac
acggagacggtcactgttgatatttcaacctggttaaatatttcggagcagttgatggtg
tatacatccagcgagggttccaatctacttctaagatcgcctgttaatatggttaccttc
agtctgtctggttcggtttctgttgtgctcgtcacagaagatttgttcgattaa

DBGET integrated database retrieval system