KEGG   Atta cephalotes (leaf cutting ant): 105619020Help
Entry
105619020         CDS       T04923                                 

Definition
(RefSeq) sorbitol dehydrogenase-like
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
acep  Atta cephalotes (leaf cutting ant)
Pathway
acep00040  Pentose and glucuronate interconversions
acep00051  Fructose and mannose metabolism
acep01100  Metabolic pathways
Module
acep_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:acep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    105619020
   00051 Fructose and mannose metabolism
    105619020
Enzymes [BR:acep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     105619020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C Pyr_redox_2 ADH_zinc_N_2 2-Hacid_dh_C Methyltransf_16 Pyr_redox_3 ThiF Phosphonate-bd
Motif
Other DBs
NCBI-GeneID: 105619020
NCBI-ProteinID: XP_012055937
UniProt: A0A158NEH9
LinkDB All DBs
Position
Unknown
AA seq 350 aa AA seqDB search
MAKDNLSAVLYGINDLRLENTIIEEPEDNEVLLEMGCVGICGSDIHYLVNGRIGDFIVKK
PMILGHESSGTVAKLGKNVTNLKVGDRVAIEPGVPCRMCTHCKEGRYNLCKDVVFCATPP
VHGNLRRFYKHAADFCFKLPDHISLEEGALLEPLSVGVHACKRGEVGISSKVLILGAGPI
GLVTLLVAKAMGAKKIVITDILQSRLNIAKKLGADVTYLVQKDRSEKDTVADIHAIFEGE
PNRTIDASGAQSSIRLAILATKSGGVIVLVGMGAPEVQIPLINALIREVDIRGVFRYVND
YGDALELISSGKIDVKSLVTHNYKLEETKQAFETCRTGAGGAIKVMIHCK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggacaatctctctgctgtactatatggcatcaacgatttacgcctggaaaat
acgattatcgaggaaccagaagacaatgaggtgcttctcgaaatgggatgtgtaggaatc
tgtggatcggacattcattatcttgtcaatggcagaattggcgatttcattgtgaagaaa
cccatgattcttggccatgagtcctctggaacagttgccaaacttggaaaaaatgttacg
aatttaaaggtcggtgatcgcgttgctattgaacctggcgtgccttgcagaatgtgtaca
cattgtaaagagggacgttataatctgtgcaaagatgttgtcttttgtgcaactccgcct
gtgcatggcaacttaagacgtttctacaaacatgcagctgatttctgttttaaattgccc
gatcatataagcttagaagaaggagcgcttttagagccattatcggtgggagtacacgct
tgtaaacggggcgaagtcggaattagttccaaagtactaattctgggagctggtccgatc
ggtttggtcaccttgctggtagccaaagctatgggtgcgaagaaaatagttatcacggat
atcttgcaaagtagactgaacatagcgaagaaacttggcgccgatgtcacgtatctggtg
caaaaggatagatcggagaaggatacagtggctgatattcatgcaattttcgagggtgaa
cctaacagaacgatagatgcctccggtgcacaatcctcgattcgtttagcgattcttgca
accaaatctggtggagtcattgtgttagtgggaatgggtgctccagaggtacaaattcca
ctaataaacgctttaataagagaagttgacatcaggggtgtttttcgatacgtaaatgac
tatggcgatgcattggagcttatctcgtctggcaagatagacgtgaagtcattggtcact
cataattacaagctagaagagaccaagcaagcgtttgagacctgcagaactggagcaggt
ggagctatcaaagttatgattcactgtaaataa

DBGET integrated database retrieval system