KEGG   Atta cephalotes (leaf cutting ant): 105619345Help
Entry
105619345         CDS       T04923                                 

Definition
(RefSeq) JNK-interacting protein 1
Organism
acep  Atta cephalotes (leaf cutting ant)
SSDB OrthologParalogGFIT
Motif
Pfam: PID SH3_9 SH3_1 PTB PID_2 SH3_2
Motif
Other DBs
NCBI-GeneID: 105619345
NCBI-ProteinID: XP_012056255
UniProt: A0A158NFE7
LinkDB All DBs
Position
Unknown
AA seq 500 aa AA seqDB search
MADSEFEEFRHYFERLPQHLKAPLSNYTLVHDVMIDDSPTSSQGSDGEVGRSCDVVTGDS
EDEEVVVIHRHDNQSGHTTPDDSEELDHHCSIIADSDFSLFGGLSSRGRSVGGGGPGPGG
GGTTMSGNGGRDSVVSDVGDSCSSLSSWPTPEHVPSNRPGSGGTERRRRRLPEIPKSKKS
VPICQTSIQTSSSLADELSAATGSTSTRPHLVLRKCHPRLRHEDSSPDSERMATDSGHST
AHSPDNGPKSVSPIPCNTLQNTDSVSPSSTPGSGGVPFTQLELLEATHRGLHKFISRHHD
EIDLEIGDPIYVQKEADDLWCEGVNLRTGRQGIFPSAYAVDMDYSDFDPTAPKVKRERYL
LGYLGSVETLAHKGTGVVCQAVRRILRNSLQDPPVSQSCILEVSDQGLRMVDRSKSRKNQ
GPCHDYFYSLKNVSFCAFHPRDHRYLGFITKHPTLQRFACHVFIGQESTRPVAEAVGRAF
HRFYTKFIETAFPIEDIYIE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggctgacagcgaatttgaggaattccggcactatttcgagaggctaccccaacatctg
aaggcaccgctgtccaactacacgctcgtacatgatgtgatgatcgatgactcgccgaca
tcctcgcaaggaagcgatggagaggtcggcagatcttgcgacgtcgtcaccggcgattcc
gaggacgaagaagtcgtcgtcatccatcgtcacgacaaccaaagcgggcacaccactcct
gatgacagtgaggagctggatcatcattgctccatcatagctgacagcgattttagcttg
ttcggtggactgagcagcaggggtcgatcggtaggcggtggcggaccaggaccgggcggg
ggtggtactactatgtctggtaacggaggccgagatagtgtcgtcagcgatgttggggat
tcgtgttccagtttgagctcttggcctacgccggagcacgtgccatcgaatcgacctgga
agtggtggcaccgaacgtagacgtcgaagactgccggaaattcctaaaagcaaaaaatct
gtgcccatatgtcagacgtccatacagacgtcgtcttcgctggcagacgagttgagtgcc
gccactggctcaacatcgacccggcctcaccttgtcttaaggaaatgtcatcccagactc
cgtcacgaggacagctcgcccgacagcgaaaggatggccacagacagcggtcattctacc
gctcattctcctgacaatggccccaagagtgtgtcgcccataccatgtaataccctgcag
aatacagactcagtgtcgcctagcagcaccccaggaagcggaggcgtaccgtttacccaa
ctggaattactcgaggcaacgcatcgaggtctgcacaaattcatatcgcggcaccacgac
gaaattgatcttgaaattggagaccccatatatgtgcaaaaagaggctgatgacctctgg
tgcgaaggtgtgaatctaaggacaggccggcaaggtatttttccatcagcttacgcggtc
gacatggactacagtgattttgatcccaccgcgcctaaagtgaagagagaaagatatctc
ctaggttacttaggatcggtggaaactttggcacataagggtacgggagtggtttgtcag
gcggtacggagaatccttcgtaactccttgcaggatccacctgtctcacagagttgcatc
ttggaagtatccgatcagggtcttcgaatggtcgatagaagcaaatcgcgaaaaaatcag
ggtccttgtcacgattatttctactcgctgaagaatgtatcgttttgtgcgtttcatcct
cgcgatcatcgctacctcggcttcatcacgaaacaccccactctgcagaggttcgcttgc
cacgtgttcattggtcaagaatccacgagacccgttgccgaagctgttggacgtgctttt
catcggttctacacgaaattcatcgagactgctttcccgatagaggacatctacattgaa
taa

DBGET integrated database retrieval system