KEGG   Atta cephalotes (leaf cutting ant): 105619919Help
Entry
105619919         CDS       T04923                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
acep  Atta cephalotes (leaf cutting ant)
Pathway
acep00562  Inositol phosphate metabolism
acep01100  Metabolic pathways
acep04068  FoxO signaling pathway
acep04070  Phosphatidylinositol signaling system
acep04140  Autophagy - animal
acep04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:acep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    105619919
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    105619919
   04070 Phosphatidylinositol signaling system
    105619919
   04150 mTOR signaling pathway
    105619919
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105619919
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:acep01009]
    105619919
Enzymes [BR:acep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     105619919
    3.1.3.48  protein-tyrosine-phosphatase
     105619919
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     105619919
Protein phosphatases and associated proteins [BR:acep01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    105619919
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 105619919
NCBI-ProteinID: XP_012056824
UniProt: A0A158NH16
LinkDB All DBs
Position
Unknown
AA seq 600 aa AA seqDB search
MFWELMGICFSCRRPTSGRLNSKISEHISASVTPLHVCLEEQRRPELGSCDASQAHKPQV
KRTFENQKAEEEIPEEVAESDSIEVEAGELRQSQPSMANTISNMKMTNPIKGLVSKRRKR
FTEDGFNLDLTYIKANLIAMGFPAEKLEGVYRNHIDDVVKLLESKHKDHYKIYNLCSERS
YDCKKFKQRVATYAFDDHNPPKLEQIKPFCEDVQSWLSQDKDNVAAVHCKAGKGRTGVMV
CCYLLHSKQFPTATEALNYYGTKRTHDRKGVTIPSQRRYVDYYATLLQEGISYEPVTLLL
RKIQLDPAPIFNGGQGCLHFVISESNKRIFSDDYEVRKGTSSICISLQHTVALTGDIRVE
FYNYKPKMKRKEKMFHFWFNTFFVREKTNSECDNGDLHERSARAFSCDGTAMELPMVMSH
LKPRTGSLASLGPMPPTLVLRIDKSGLDKVHKDKNHKLYSPDFKVSLFMHSVGGNISPAV
PATTNRGSDGVQLGMGGQETPSESSEADSSECDTTGDEDGWESGESSASLVVNHQHHHPL
THSSSRTHVSSLRPRCSLKETAKGLLSRGDKNRNSNRQGVSGASVKRSSAPFARSATLDT
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgttctgggaattgatgggtatatgcttttcctgcaggagacccaccagcggcaggttg
aacagtaaaatctctgagcatatctcggcctctgtaactcctctccatgtttgtctggag
gaacaaagaagaccagaactgggctcatgtgacgcctcacaagctcacaagcctcaggtt
aaaagaacctttgagaatcaaaaggcagaagaagagattcccgaggaggtggcggaaagt
gattcgatcgaagtcgaagcaggagagttaagacaaagccagccgagtatggccaatact
atcagcaacatgaagatgactaatcccataaaggggctggttagcaaacgccgcaaacgt
ttcacagaagatggttttaatcttgatctcacatatataaaagcgaatttaatagcgatg
ggttttcctgctgagaaactggaaggagtgtatagaaatcatattgatgacgttgttaaa
ctactggaatcgaagcataaagatcattataaaatttataatctgtgttctgagagatcg
tatgattgtaaaaagttcaagcagagagtagctacttatgcatttgatgatcacaatcca
ccaaagctggagcagattaagcctttctgcgaggacgtgcagtcgtggttatcccaagat
aaggacaatgtggccgcagttcattgcaaggcgggcaaaggtcggacgggtgtaatggtg
tgctgctatttacttcacagcaaacagtttcccactgccacggaagcccttaattattat
ggaactaaacggactcatgataggaaaggcgtaacgataccatcgcagagaaggtatgtg
gattattatgctactctcctccaagaaggtatcagttatgaaccagtgacattattactg
cgtaaaatacaactggatccggctcctattttcaatggaggtcaaggctgtctgcatttt
gtaatctcggaatcaaataaaaggatattttctgatgattatgaggttcggaaaggtaca
tcttctatatgcatctcactgcaacacactgtcgctctaacgggagatatacgggtggag
ttctataattataagccaaaaatgaaacgaaaggaaaagatgtttcatttttggtttaac
acatttttcgtccgtgagaaaacgaattccgagtgcgacaatggcgatttacatgaaaga
tcggcgagagcatttagctgcgacggcacagccatggaattgccgatggttatgtcgcat
ctgaaacctagaactggatcattggcgagtctcggtcctatgccgcccactctcgtttta
cggatagataagtcaggattggataaagtacacaaggataaaaatcacaaactatacagt
ccggattttaaagtgagtctatttatgcatagcgtgggtgggaacatatcgccagctgtg
ccagcgacgacgaacagaggtagcgatggtgtgcagctggggatgggtggtcaggagaca
ccaagcgagtcgagcgaggcagacagcagcgagtgtgacactaccggtgacgaggacggt
tgggaatccggtgagtcctctgcatccctggtggtgaaccaccaacaccaccaccctctt
acacacagcagtagccgtacacatgttagcagtctccgtccgcgatgcagtcttaaggag
actgccaagggtctgctgtcgcgcggcgacaagaatcggaacagtaacaggcagggtgtc
tccggtgcgagcgtgaaacgttcatccgcaccgttcgctcgctcagccactctcgacacg
tag

DBGET integrated database retrieval system