KEGG   Atta cephalotes (leaf cutting ant): 105619946Help
Entry
105619946         CDS       T04923                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
acep  Atta cephalotes (leaf cutting ant)
Pathway
acep00020  Citrate cycle (TCA cycle)
acep00190  Oxidative phosphorylation
acep01100  Metabolic pathways
acep01200  Carbon metabolism
Module
acep_M00009  Citrate cycle (TCA cycle, Krebs cycle)
acep_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
acep_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:acep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    105619946
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    105619946
Enzymes [BR:acep01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     105619946
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA DAO FAD_binding_3 HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 105619946
NCBI-ProteinID: XP_012056850
UniProt: A0A158NH42
LinkDB All DBs
Position
Unknown
AA seq 662 aa AA seqDB search
MSGLLKLSASLLPRSLPGSATLNKLGLPLLGNRRFHHTPDRTAKISNEISKQYPLVDHTY
DAVVVGAGGAGLRAAYGLVAEGFKTAVVTKLFPTRSHTVAAQGGINAALGNMEDDNWQWH
MYDTVKGSDWLGDQDAIHYMTREAPKAVIELENCGMPFSRTTDGKIYQRAFGGQSLKFGK
GGQAHRCCCVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLLMEDGECRGVIALSLEDG
TLHRFHAKNTVLATGGYGRAYFSCTSAHTCTGDGTAMVSRANLSNQDLEFVQFHPTGIYG
AGCLITEGSRGEGGYLINSEGERFMERYAPVAKDLASRDVVSRSMTMEIREGRGVGPEKD
HIYLQLHHLPPEQLAARLPGISETAMIFAGVDVTRESIPVIPTVHYNMGGVPTNYKGQVL
TRENNQDKIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACAKTIAQENKPGEAIG
LLKPNAGEETVANLDWVRNANGSISTAELRLTMQKTMQMHAAVFRDAESLQEGCRKMSVL
YKKLNELKVADKSLIWNSDLIETLELQNLMINAMQTIIGADNRKESRGAHAREDYKQRID
EYNYSKPIENQQPKPFNQHWRKHTLSKINPKTGEVSLDYRPVIDVTLSQQECATVPPAIR
SY
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgagcggattactgaagctgtcggcgtcgttgctgccgagaagtctgcccggatcggcg
acgctgaacaagctgggactgccacttctcggcaaccgcaggtttcaccacacgccggac
cgaacagccaagatttccaacgaaatctccaaacagtacccgttagtggatcacacgtat
gatgcggtggtggtgggagccggcggtgctggtctacgcgcagcttacggcctcgtcgcc
gaaggattcaagactgcagtggtcaccaagctgttcccgacgagatcgcacacagtcgcc
gcccagggcggcatcaatgccgccctgggcaacatggaggacgataactggcaatggcac
atgtacgacaccgtcaagggctcggactggctaggcgatcaggatgccattcactacatg
acccgcgaggcaccgaaggccgtcatcgagctggagaattgtggcatgcccttcagtcgc
actaccgacggcaagatctatcaacgcgcttttggtggtcaatcccttaaatttggcaag
ggcggtcaggctcatagatgctgttgcgtagctgacaggaccggccattcattgctacac
acactttatggacagtcgctaagctacgattgtaattacttcgtcgagtattttgccctc
gatttgctaatggaagacggcgaatgtcgcggtgtgatcgcgctctccttggaagatggg
acgttgcatcgtttccatgccaagaatacagtgctcgctaccggtggctacgggcgcgcc
tacttttcctgcacatctgcacatacctgtactggagatggtaccgctatggtctctaga
gctaatctatccaatcaggacctagaatttgtgcaatttcatcctacaggtatctatggc
gccggatgtttgattacagaaggtagtcgtggcgaaggtggttatttgataaatagtgag
ggtgagaggttcatggagcgttatgcgccggtagcgaaagatctggcttcgcgagacgtg
gtgtctagatctatgacaatggagattagagagggcagaggcgtcggaccagaaaaggat
cacatttacttgcagctacaccatctgccacctgaacaattggccgcacggctacctggt
atttcggagacggcaatgatattcgctggcgtcgatgtaacccgggaatctatccctgtc
attcccaccgtccattacaatatgggaggagtaccgacaaattacaaaggtcaagtgttg
accagagagaacaatcaagacaaaatagtacctggcttatatgcatgtggtgaagcagct
tgcgcatccgttcacggtgctaatcgactgggtgctaattctctattggatttagtcgta
tttggacgtgcttgtgctaaaactatcgctcaagagaataagcctggcgaagcgatcgga
ctcctgaaacctaacgctggcgaagagacggtagctaatttagactgggtcagaaatgcc
aatggttccatctccaccgcagaattaaggttaaccatgcagaagactatgcaaatgcac
gcggcagttttcagagacgccgaaagtttgcaggaaggctgtcggaaaatgtccgttctc
tacaaaaaactgaatgagttaaaagtcgcggataaatctttaatatggaattccgatttg
atagaaacgcttgagctgcaaaatctcatgatcaatgcaatgcagactattattggggcg
gacaacagaaaggagagtcgtggtgcgcatgctcgcgaggattacaaacagagaatcgat
gaatacaattatagtaaaccgatcgaaaaccaacaaccaaaacctttcaatcaacattgg
aggaagcacacgctgtcaaagattaatccgaaaacaggagaggtgtctctcgactataga
ccagtgattgatgttacgctcagtcaacaggaatgtgcgacggttccgccagcgattcgt
tcctactag

DBGET integrated database retrieval system