KEGG   Atta cephalotes (leaf cutting ant): 105620050
Entry
105620050         CDS       T04923                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
acep  Atta cephalotes (leaf cutting ant)
Pathway
acep00230  Purine metabolism
acep01100  Metabolic pathways
acep04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:acep00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    105620050
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    105620050
Enzymes [BR:acep01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     105620050
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF2258
Other DBs
NCBI-GeneID: 105620050
NCBI-ProteinID: XP_012056949
UniProt: A0A158NHE1
LinkDB
Position
Unknown
AA seq 1001 aa
MSQQAPTNEDSYLRCGRPSNLLKTSFSSARLEKLYRASSLQQRRGGLTCFLMSAILYGLY
TVSTPGMELPARCVSAVFLSLNFFLLIWAESGTKARNSLWSVVPCVVGELWIVHLSAQLF
LKSNKVTPMDSLAWMLLLLYLLFATLPLKLLRCANLTASSILLYLIAIIGLSSRTLEDLT
SQPIDVLILTMTLFIGASILGACGYYLAEFQQRRAFLETRQSLEAQLMIEEQSAEQERLL
LSVLPEHVAVKMRQDLGASFDTQFKKIYMSRHENVSILYADIVGFTAISSTYSASELVKI
LNELFARFDQLSERYEQMRIKILGDCYYCISGAPVERPDHAVLCVYMGLSMVEAIKYVQQ
TTNSPVDMRVGIHTGAVLAGVLGQRQWQFDVYSKDVELANKMESSGRAGRVHISNSTLSF
LNGEFEVEPAHGEDREEALQKAGLVTYFIVRALKPFKPAVTKSLASLADAENSQRIIENV
QDKVDNIREDSEEFQQRLRKKLDSRGGGTDLKGHASWLTLRFKDPNVETAFHSVEEAFSP
LSLLGGPLVTMCAAPVWKMQPWGPFTWGGAGVVTLFGIVLAGATCLGRAVRAAWFRSTLA
LLMIFSLIIFLLLDMANCAIIDDIEPLKNTTLKWSPRCPYPSYYSYVGVLALVAISMPTY
LCYLTKACLMYFLAGAQSCINVLFLSSSLNREEMACYRDISFPLKYSLAATLFTIATALV
IVARYAEKARRMLYLRGREVIAQRERAADMKRRNGALIYNILPPHVAAYFLSHARHYDDL
YSQSYAEVGVLFASMPNFADFYSEESINNQGLECLRFLNEVISDFDAILDQKKFHSIIKI
KTIGSTYMAASGISEVQSMQSEDAPRWSHLVTLVEFALELKKALSSINEQSFNHFVLKMG
INHGPVTAGVIGARKPHYDIWGNTVNVASRMESTGKVACIQVTDETRKILEPFGFGFEQR
GLVFVKGKGQLLTHYLVSKDGVFLDLDSDLPVEPTHPIIYQ
NT seq 3006 nt   +upstreamnt  +downstreamnt
atgtcgcagcaagccccgacgaatgaggattcttacctgaggtgtggcaggccatcgaac
ttgctgaagacgagctttagcagtgcccgcctcgagaagctgtatcgtgcgtcatcgttg
caacaacgtcgcggcggcctcacgtgtttcctgatgtcagcgatcctgtacggcctctat
acagtgtcgacgccggggatggagctgccggcgcgttgcgtcagcgccgtgttcctcagc
ctcaatttcttcctgttgatttgggccgagagcggtaccaaggcgcgtaactcgctctgg
tcggtggtgccgtgtgtggtcggagagctatggattgtgcacttgtccgctcagctgttc
ctcaagtccaacaaggtcacgccgatggacagcctggcgtggatgctgctacttctctac
ctactgttcgccactctaccgctcaagctattacgttgcgctaacttaacagcaagcagc
attctcttgtacttaatcgccataatcggtctctccagcaggacgctggaggatcttaca
tcacagcctatcgacgttctgatcctgacgatgacgctgttcatcggcgcctctattttg
ggtgcctgcggctattacctggcggagttccagcagcgccgtgcgtttttggagaccagg
cagagcctggaggctcagctgatgatcgaagagcagagcgcggagcaggagcgactgttg
ctgagcgttctgccggaacacgtcgcagtcaagatgcggcaggatctcggcgcgtctttt
gacacgcaattcaagaagatctacatgtctaggcatgaaaacgtgtcgatactctatgct
gacatagtcggcttcaccgcgatctcgtcgacctacagcgccagcgagctagtcaagata
ctcaacgagctcttcgcgcgattcgaccagctcagtgaacgatacgagcaaatgcgcatc
aagatattaggggattgttattactgcataagtggcgcacctgtcgaaaggccagaccat
gcggtcctttgtgtgtatatgggtctgtctatggtggaagcgattaaatatgttcagcaa
acgactaacagccccgtcgatatgagagtgggtattcacacgggtgcggtactcgccggg
gttctcggacagaggcaatggcaattcgatgtctacagcaaagacgtcgagttggcaaat
aaaatggagagtagtggtagggcggggagggtacacatctcgaattcgacgctgagtttc
ctaaatggggaattcgaggtcgagccggcgcacggagaggatcgggaagaggcactccag
aaagctggcctcgtcacttacttcatcgtaagagccttgaagccatttaagccagcagtg
acgaaaagcctcgcgtcactggcggacgcggaaaactcgcaaagaataatagagaatgtg
caagacaaagtggataatattcgagaggattccgaggaatttcagcaacgtctaaggaag
aaacttgacagcagaggtggtggaactgacctgaaaggtcacgcctcttggttgacacta
cgattcaaagatccgaatgtggaaacggcgtttcacagcgtcgaggaggccttctcgcct
ctgtcgcttcttggtgggcctctggtcacgatgtgcgcagccccggtctggaagatgcag
ccctggggaccattcacgtggggtggcgccggggtggtaactcttttcggtatcgtgctg
gccggagctacctgcctaggcagagcggttagggcggcgtggttcaggagtaccctcgca
cttctgatgatattctccctcataatctttctgttgttagatatggctaactgcgcgatc
atcgatgacatcgagccactaaaaaacactactctaaagtggtctccgcgatgtccatat
ccttcttattattcatacgtcggtgtccttgcgctggtcgctatctcgatgccgacatat
ctctgttacctgaccaaggcgtgcctgatgtacttccttgccggtgcgcagtcctgcatc
aatgtcctgttcctttcatcgagcctcaacagagaagaaatggcatgttatcgagacata
tcctttccactaaaatattcattagcagccactttgttcactatcgcgaccgcgttagtc
atcgtggcgagatacgccgagaaggcacgaaggatgctgtatctgcgaggacgagaggta
atcgcgcaaagggaacgagcagcggacatgaaacgaagaaatggagcactaatatacaac
attttaccacctcacgtagccgcatatttcttatcgcatgcaaggcattacgacgatctt
tacagccagagctacgccgaagtgggcgtgctatttgccagtatgccaaacttcgcggac
ttctacagcgaggagagcatcaacaatcaaggcctcgagtgtctcaggttcctgaatgag
gtcatctctgacttcgacgccatcctcgatcagaagaaattccatagtatcatcaaaatt
aagacgataggatcgacctacatggcagcttcgggaatatccgaggtgcaatcgatgcag
tcagaggatgctcctcgatggagccacctcgtcactcttgtggagttcgctctggaactt
aagaaagccctatcaagcattaacgagcagagttttaatcacttcgttttgaaaatgggc
attaatcatggaccggtgactgctggcgtcatcggggcgcggaaacctcactatgatatt
tggggcaacaccgtcaatgtcgcgtcgaggatggagagcacggggaaagtcgcctgcatt
caggttaccgacgagacacgaaagatattggagccgttcggtttcggctttgagcaacga
ggtcttgtcttcgttaagggcaagggtcagctcttaacgcattatcttgtctccaaagat
ggcgtttttctcgatcttgatagcgatctccctgttgaacctacccacccgataatctat
cagtaa

DBGET integrated database retrieval system