KEGG   Atta cephalotes (leaf cutting ant): 105620164Help
Entry
105620164         CDS       T04923                                 

Definition
(RefSeq) glycogen [starch] synthase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
acep  Atta cephalotes (leaf cutting ant)
Pathway
acep00500  Starch and sucrose metabolism
acep01100  Metabolic pathways
Module
acep_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:acep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    105620164
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:acep01003]
    105620164
Enzymes [BR:acep01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     105620164
Glycosyltransferases [BR:acep01003]
 Polysaccharide
  Storage polysaccharide
   105620164
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 105620164
NCBI-ProteinID: XP_012057060
UniProt: A0A158NHQ2
LinkDB All DBs
Position
Unknown
AA seq 566 aa AA seqDB search
MSRERASRRFYRIDSTNDLFGFMDRGYSAQHENRWNFEVAWEAANKVGGIYTVIRSKAYV
STEEMGDQYCLIGPYKEHSARTEVEEADFPPHNPLHQAVQVLRDQGYKNINKFSVDEEAG
KRQIYHRYCMERAATHLAHVFTTVSDITGFEAEHLLKRKPDIITPNGLNVKKFAALHEFQ
NLHAISKEKIHEFVRGHFYGHYDFDLDKTLYFFTAGRYEFGNKGADIFIEALARLNHYLK
TSRPDLTVVAFLIFPARTNNFNVESLRGHAVTKSLRDTINDIQQKIGKRMYELCLSGRMP
EAQDLLEKEDTIKIKRCLYALQRNGLPPITTHNVVDDWNDPVLNAIRRCNLFNTVHDRVK
MVFHPEFLSSTNPLFGLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSITTNLSGF
GCFMQEHIADPMSYGIYIVDRRFIGLEASVQQLAQYMFDFARLSRRQRIIQRNRTERLSD
LLDWRNLGIYYRQARIKALTTLYSELASEYAEGGIGRFNYPRPISEPPSPLSSRHTTPAA
SVHGSDDEDEVDDEKELEELRQSNGR
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagagagcgtgcttctagaagattttatcgcatagatagcactaatgatttattt
gggtttatggaccgtggctattcagcccaacatgaaaatcgatggaactttgaagttgct
tgggaagctgccaataaagttggtggtatttatactgtaataagatctaaagcttatgtc
tcaactgaagaaatgggtgatcaatattgccttattggtccatataaagaacattcagca
cgtactgaagttgaggaggcagactttcctcctcataatccgttgcatcaagcagtacaa
gttttacgtgatcaaggatataaaaatattaataagttcagtgttgatgaagaagcaggg
aagcgtcagatatatcatagatactgtatggaacgtgcagctacacatttagcacatgta
tttacaacagtttcggatattaccggttttgaagctgaacatttgctcaaacggaaacct
gatattatcacgccaaacggattaaatgtaaaaaagtttgcggcattgcatgaatttcag
aatttacatgctattagtaaagaaaaaatacatgagtttgtgcgaggccacttttatgga
cattatgattttgatttagacaaaacattatatttctttaccgctggtcgatatgaattt
ggaaataaaggagctgatatattcatagaagctctggccagattaaatcattatttaaaa
acgtccaggcctgatttaacagtggttgctttccttatttttcctgcaagaactaataac
tttaatgtcgagtctctccgtggtcatgctgtaacaaaatctttacgagatactatcaat
gatatacagcaaaaaatagggaaacgaatgtatgaattatgtctctctggtcgcatgcct
gaagctcaggacttgttggagaaagaggatactattaaaataaaacgatgtttatatgct
ctgcaaagaaatggattaccacctattacgacacataatgttgttgatgattggaatgat
ccggtgttaaatgccattagaagatgtaatcttttcaacactgtccatgatcgtgttaag
atggtatttcatccagaatttttatcttcgacaaatccactatttggtcttgattatgag
gaatttgttagaggatgtcatttaggtgtttttccttcatattatgaaccatggggttat
acaccagctgaatgcacagttatgggaatacccagcattactactaacttatcaggattt
ggatgttttatgcaggagcatatagcagatccgatgagctatggtatttacattgtcgat
aggcgttttattggtttagaagcaagtgttcaacagcttgctcagtatatgtttgatttc
gcacgacttagccgtcgtcaacgtatcattcaaagaaatcgtacagaacgtcttagtgat
ctcctcgattggcgaaatcttggcatttattatcgtcaagcaagaataaaggcgttaacc
acattgtattcagaactagcgtcagaatatgcagagggtgggattggtcgatttaattat
cccagaccaatcagtgaaccgccatctccattatcttcacgacatacgacaccggccgct
tctgtacatggttcagatgacgaggatgaagttgatgatgaaaaagagctagaagaatta
cgacaatcaaatggaaggtaa

DBGET integrated database retrieval system