KEGG   Atta cephalotes (leaf cutting ant): 105620881Help
Entry
105620881         CDS       T04923                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
acep  Atta cephalotes (leaf cutting ant)
Pathway
acep04140  Autophagy - animal
acep04213  Longevity regulating pathway - multiple species
acep04310  Wnt signaling pathway
acep04341  Hedgehog signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:acep00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105620881
   04341 Hedgehog signaling pathway - fly
    105620881
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105620881
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    105620881
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acep01001]
    105620881
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:acep03019]
    105620881
   03036 Chromosome and associated proteins [BR:acep03036]
    105620881
Enzymes [BR:acep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     105620881
Protein kinases [BR:acep01001]
 Serine/threonine kinases: AGC group
  PKA family
   105620881
Messenger RNA biogenesis [BR:acep03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     105620881
Chromosome and associated proteins [BR:acep03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    105620881
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Bac_GDH
Motif
Other DBs
NCBI-GeneID: 105620881
NCBI-ProteinID: XP_012057748
UniProt: A0A158NJP0
LinkDB All DBs
Position
Unknown
AA seq 353 aa AA seqDB search
MGNNAATANKKVDAAESVKEFLDKAKKEFEDKWKKNPTNTAALDDFERIKTLGTGSFGRV
MIVQHKPTKEYYAMKILDKQKVVKLKQVEHTLNEKRILQAISFPFLVSLRFHFKDNSYLY
MVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQ
GYLKVTDFGFAKRVQGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPP
FFADQPIQIYEKIVSGKPRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKGHKWF
ASTDWIAVFQKRIEAPFIPRCKGPGDTSNFDDYEEETLRISLTEKCAKEFAEF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacaatgccgcgaccgccaacaagaaggtcgacgccgccgagagcgtcaaggaa
ttcctcgataaagcgaagaaggagttcgaggataagtggaaaaagaatccgaccaatacc
gccgccttggacgattttgaacgtatcaagaccctcggcaccggttcgttcggtcgcgtg
atgatcgttcaacacaaacccactaaagagtattacgccatgaagatactcgataagcaa
aaggtcgtaaagctgaaacaggtcgagcatacgctcaacgagaagaggatactgcaagct
atcagttttccattcctcgtatcgttgcgttttcacttcaaggacaactcttacctgtac
atggtgttggagtacgtgcccggtggcgagatgttcagccacctgcgcaaggtcggccgc
ttctccgagccgcactcgcgtttctacgcggctcagatcgtcctcgcgttcgagtacctg
cactacctcgacctcatctatcgggacctgaaaccggagaatttgctaatcgactcgcag
ggctacctcaaggtcaccgatttcggtttcgccaagagagtgcagggacgaacgtggact
ctatgcggcacgccggagtatctagcgcccgagatcattctcagcaagggttacaacaag
gcggtggattggtgggcactgggcgtgctggtctacgagatggccgctggctatccacca
ttcttcgccgaccagccgatccaaatctacgagaagatcgtgagcggcaagccacgcttc
ccgtcgcatttcggctccgatctcaaggatctattgcgcaatctgctgcaggtcgacctc
accaagaggtacggcaacctcaaggcgggcgtaaacgacatcaagggccacaagtggttc
gctagcaccgattggatagccgtcttccagaagcgaatagaagcgccgttcataccgcgc
tgcaagggaccaggcgacaccagcaatttcgacgattacgaggaggagaccctgaggatc
tcgctgacggaaaagtgcgccaaggagttcgccgaattttga

DBGET integrated database retrieval system