KEGG   Atta cephalotes (leaf cutting ant): 105621803Help
Entry
105621803         CDS       T04923                                 

Definition
(RefSeq) fatty acid synthase-like
  KO
K00665  fatty acid synthase, animal type [EC:2.3.1.85]
Organism
acep  Atta cephalotes (leaf cutting ant)
Pathway
acep00061  Fatty acid biosynthesis
acep01100  Metabolic pathways
acep01212  Fatty acid metabolism
Module
acep_M00082  Fatty acid biosynthesis, initiation
acep_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:acep00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    105621803
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:acep01004]
    105621803
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acep04147]
    105621803
Enzymes [BR:acep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.85  fatty-acid synthase system
     105621803
Lipid biosynthesis proteins [BR:acep01004]
 Fatty acid synthase
  Animal type
   105621803
Exosome [BR:acep04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105621803
  Exosomal proteins of breast milk
   105621803
  Exosomal proteins of colorectal cancer cells
   105621803
  Exosomal proteins of bladder cancer cells
   105621803
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: KR Acyl_transf_1 KAsynt_C_assoc ADH_zinc_N_2 PS-DH ADH_zinc_N PP-binding Thioesterase adh_short adh_short_C2
Motif
Other DBs
NCBI-GeneID: 105621803
NCBI-ProteinID: XP_012058645
UniProt: A0A158NM87
LinkDB All DBs
Position
Unknown
AA seq 1874 aa AA seqDB search
VIIAFETGFVPPNINYTTPRNDIDALINGTVRVIEKPMQLQNGYVGINNFGFGGSNAHVL
LKWNDKLKINNGTPNDDLPRLVVLSGRTEESVKLFLNDIANHPIDVEYIRLLHDIYADNI
KNHPWRGYIILNSFQQDSIKEIQNCEDVKRPVWFIFSALGSQWPGMGQNLLKFHTFAKTI
RKCDDILKPYDISVTDILTKADKSICENTLNVYLGIVAIQIGLVDLLTSLGITPDYMIGH
SGGELGCAYADKCLTIEQTILSAYFIGITCAKERIIHSSMAVINLSYEHLKNICPLDIEI
VCYNSKNSSIVCGPPESVQEFMKKLKISSISPPLSPSIRWCHSENWLTSSAEQKYIKSRG
RYINIILDDEDYEYMSGHVIDGRNLLPATGYLGFVWQMIGMMKGSMYTTIPIVFRDVKFI
RAAHLSKNDATELFIAIQKNGQFEITDGDSVLVTGTAYETENPEQEMISIDLLPENNDEE
EYMTARDIYKELKLRGYQYSGWFRGLKSASISGSQGQIIWKNNWVTFMDTMLQMLIIGYD
TRDLYVPTSIQKLVINPMLHACKLQNNADDEDVHTTDIDKLLQARMYKEINTIKAGGVEI
RGMKATQISRRKLEQDAVIEEHTFIAHCDHAKISLNKAIRLSAQLVLEDHQIIKVRAVEL
VEDVDDVELEYLSSSLLLEAFGDMPLIQVNITLLTSSNRFRPEDLPQNCSIKDIEQSSID
DKALIVTGFNLLTKQHASLERLLPFLGEGGYLLTREKCDIIDYKKRLQQYELNVILEKRT
EKEIIVLLKKKVLIKERTVVYISNDNFNWLENLKSLVSDKKFDKNSRIIIVGEGDFECGL
LGFVNCLRKEPGGELVRGVLLQDEEAPKFSLEDPFYLEQLQKDMTINVLRSNKTWGSYRH
LKLSQPEAKLVPTAHICQMVRGDLSTLCWIENNLLNMCCRENLVHIVYSSLNFKDIMFAT
GKLTFHHEMILEGRLFQYLPLGMEYAGFNANGQRIMGIRDTNCIANVVEIDEDLCWYIPD
AWTFEEAITIPCVYSTVYLALYIYGKIKEGDKILIHSGTGGIGQAAIHLALKEGCQVFTT
VGTSDKRNFIRKIFPTILDEHIGNSRDTSFEQMIMQQTKGRGVDIVLNSLAEEKLIASVR
CLAHNGRFLEIGKFDLVSNNPLDMSVFQKGISFQGIKVENMMIKSRDSKWKRLLFTLIKN
GLSDGTIKPIQAKIFPKTNVEEAFRYMASGKHMGKIIINIHEKDEPLDKHILAYRRYYCL
KDRSYIILGGLGGFGLELTDWLIFRGARNIVLISRNGIKNGYQRMKVRLWKSYGVNVLII
KNIDVADLKDCEYLLRTAEKEAPVDAIFNLGVVLRDGIFKNQTAEAFAESFQSKARATQM
LDKLSREICLNLRHFVVFSSVSCGRGNAGQTNYGMANSIMERICEKRAEKGLPGLAIQWG
AVGDVGLVADMMEDDKELIIGGTLQQKISCCLNELDKFLLQVRPIVSSMVVAEKKVGCHG
SLVETVANILNISDIKVVSPNSSLAELGMDSMMAVEIKQTLEREFDIFITAQDTRNLTFA
KLIKMSVASISEDDANDEKKINLEKSDVIKILVGITLKDEDFVFSTDFSTNKQNTTTEVF
LIPGIDGCSPVFKTIIPYIKFSTSLLHYNGNNIDSTNVITETTNRLTNRILPKLTEGTNF
VMVGYSFGSLIAIEVTRILEAMNFKGRLILIDGAPELARTMFKPFELEFDDANFQIDILI
NILEIYSAGSSQKILMELKKCESWNERFNIFAKQFSTIYPYLSFANLKTLCTTIYKHLSL
LRQYDPYTLPPIKSPIILLKCTHSSNMIAIEEDFCLHKVTQNVVKVHYIEGDHVTILKNK
KVAAAINGELPFTI
NT seq 5625 nt NT seq  +upstreamnt  +downstreamnt
gtaataatagcatttgaaaccggttttgttccaccgaatatcaattatacaacgccaagg
aatgacatagatgccttgataaacggaacagttcgtgtcatcgaaaaaccaatgcaactt
caaaatggttacgtaggaattaataatttcggttttgggggatccaatgctcacgtgtta
ttaaaatggaatgataaactgaaaataaataatggaacaccaaatgatgatttacctaga
cttgttgtattatctggacgcactgaagaatcagtgaaattgtttttaaatgatattgct
aaccatccaatagatgtagaatatattcgcttattacacgatatctatgcagacaatata
aaaaatcatccatggagaggatacattatattgaattctttccaacaagattcaataaag
gaaattcaaaattgtgaagacgtgaagagacctgtttggtttatattttcagccttgggt
tctcaatggccaggaatgggtcaaaacttattaaagtttcatacttttgcaaaaacgata
agaaaatgtgatgatattttaaaaccgtatgatataagtgtcacagatattttaacaaaa
gcggataaatcaatatgcgaaaacacgttaaatgtttatcttggaatcgttgctattcag
attggattagtagatctcttaacatccttaggaattactcctgattatatgattggtcat
tcaggcggtgaacttggatgtgcatacgcagataaatgtctgaccatagaacaaactatt
ttatcagcatactttatcggtataacgtgtgccaaagaaagaataattcatagctcaatg
gcggttatcaatttaagttacgagcatcttaaaaatatatgtccattggatattgaaatt
gtatgctacaacagcaaaaatagcagcatcgtatgtggaccaccagaatctgtacaagaa
tttatgaaaaaattaaagatttcctccatctctccccccctctccccatctatcagatgg
tgtcattctgaaaattggcttacatcaagcgcagaacagaagtacattaaatcaagagga
aggtacatcaacattatacttgatgatgaagattatgaatatatgagcggtcatgtgatc
gatggaagaaatttattacccgcgacaggttatttaggattcgtttggcaaatgattggc
atgatgaaaggatcaatgtacacaacaataccaatagtctttcgagatgtaaaatttatt
cgagctgctcatttgtcgaaaaatgatgctacagaactatttattgcaatacagaaaaat
ggacagtttgaaataactgatggagatagcgttcttgtcacaggtacagcgtacgagaca
gagaatccagaacaggaaatgatttcaatagatttattaccggagaataatgatgaagaa
gaatacatgactgcacgagatatctataaagagttgaaattgcgtggatatcagtacagc
ggctggtttcgtggattaaagagtgcctctatttcaggaagccaaggacaaatcatttgg
aaaaataattgggtaacattcatggatactatgttacagatgttaattatcggatacgat
actagggatctgtatgttcctacaagtattcaaaaattagtgatcaatccaatgcttcac
gcatgtaagctacagaacaacgcggatgacgaagatgttcacacaacagatattgacaaa
cttttacaggcacgaatgtacaaagagataaatacgataaaagctggtggagtagagatt
cgaggcatgaaagctactcagatctctcgccgaaaattagaacaagatgctgttattgag
gaacatacatttatagctcattgtgatcacgctaagatttctttgaacaaagcaattcga
ttatcagctcaacttgtattggaagatcatcaaattatcaaagtgcgagctgttgagtta
gtggaagatgtcgatgatgttgaattagaatatctttcatcatcactgctacttgaggca
tttggtgacatgccactaatacaagtaaatatcactctattaacatcatcaaatcgtttc
agaccagaagatttaccgcaaaattgttcaatcaaagatattgaacaatcgtctatagat
gacaaagctttaattgttactggattcaatcttttgaccaaacaacacgcatcgttagag
cgactgttgccatttttgggagagggaggttatctgctgactcgtgagaaatgcgacata
attgattataaaaaacgtttgcaacaatatgaattaaatgtcattctcgaaaaacgcact
gaaaaagaaataattgttttattgaagaaaaaagttttaataaaagaaaggactgttgtt
tatataagtaatgataattttaattggttggaaaatttaaagtcgcttgtaagcgataag
aaattcgacaagaatagcagaattataattgtaggagagggagactttgaatgtggttta
ttaggttttgttaactgtttgagaaaagagccaggtggagaacttgttagaggtgtgctc
cttcaagatgaggaagcacctaaattctctcttgaagatcccttctatctagagcaatta
cagaaagatatgaccattaatgtactgcgatctaataaaacttggggatcgtacagacat
ttgaaattatcacaacccgaagctaaacttgtacctaccgctcatatctgtcaaatggtt
cgtggtgatttaagtacactttgttggatagaaaataatctattaaacatgtgttgtcgt
gagaatttggtgcatattgtttactcatctctgaattttaaagatataatgtttgccact
ggtaaattaacatttcatcatgagatgattttagaaggacgattatttcaatatcttcct
cttggaatggaatacgcgggattcaatgctaacggacaacgtataatgggaattcgtgat
actaattgcatagcaaacgtcgttgagatagatgaagatctttgttggtatatacccgat
gcgtggacatttgaagaggcaataacgatcccgtgcgtttacagcacggtttatttagcc
ttatacatttatgggaaaataaaagaaggtgataaaatacttatacattctggtactgga
ggcattggacaagcagctatacatcttgctcttaaagagggatgtcaggtatttactaca
gtgggcacgagtgataaacggaattttattagaaaaatatttccgactattttggatgaa
catattggaaattctcgagatactagttttgaacaaatgataatgcagcagacgaaaggt
cgtggagtcgacattgtattaaattcattggcggaagaaaaattaatcgcctccgttcgg
tgtttagctcacaatggtcgattcttagagattggcaaattcgaccttgtttctaataat
cccctagatatgtctgtatttcaaaaaggtatcagttttcaagggattaaagttgaaaat
atgatgataaaaagtagggattccaagtggaaacgtttattattcacattgatcaaaaat
ggtctaagtgatggaacaattaaaccaatccaagcaaaaatttttccaaaaacaaatgtt
gaagaagcttttagatatatggcgagcggaaaacatatgggaaagattattataaatatt
catgaaaaagatgaacctttagataagcacattctcgcgtatcgtcgctattattgtctc
aaagataggagttacattatattaggaggcctgggcggatttggtttagaattaacagac
tggcttatatttcgtggtgccagaaacatcgttctgatttcaagaaatggaataaaaaac
ggttatcaacgcatgaaagttcgactatggaaatcatatggcgtaaacgttctgatcatt
aagaatatcgatgttgctgacctcaaagattgcgaatatcttttacggactgcggaaaaa
gaagctccagtggacgctatattcaatctcggtgtggtactgagggatggcatcttcaaa
aaccaaactgcagaagcatttgcagaatccttccaatcgaaggctcgtgcaacgcaaatg
ttagacaagctttctagggaaatctgtcttaatctgcggcattttgtggtattctcttcc
gtttcttgcggcagaggaaacgctggtcagacaaattatggcatggccaactctattatg
gaaagaatttgtgagaaaagagcggagaaaggattgccgggattggcgattcaatgggga
gctgtgggtgacgtggggctcgtcgctgacatgatggaggatgataaggaattaattatc
ggaggcactctacagcaaaaaatatcttgctgtctcaacgagctcgataaatttttactt
caagttcggcccattgtgagcagcatggtcgtagctgaaaaaaaagtgggatgtcacgga
agtctggtagaaacagttgctaatattttaaatataagtgacataaaggttgtaagtcca
aattcatctctggccgaactcggaatggattctatgatggccgtagaaatcaaacaaact
ctggaacgagaatttgatatatttatcacagctcaagatacacgaaatctcacttttgca
aaacttattaagatgtccgttgcaagcatcagtgaggatgatgcgaatgatgagaagaaa
atcaacctagaaaaatcagacgttataaaaattttagttggtattacattaaaagatgaa
gattttgttttctcaacagatttttcaactaacaaacagaacactacgactgaagtattt
cttataccgggaattgacggatgtagtcctgtatttaaaactataataccatatattaag
ttttcaacatcgttgttgcattataacggaaacaacattgattctacaaatgtgataacg
gagactactaatcgtctgacaaaccgcatacttccaaaactaacagaaggaacaaatttt
gtaatggtagggtactccttcggatctcttattgcaattgaagtaacaaggatattagaa
gctatgaattttaaaggccgacttattctcatcgacggggctcctgagctagcacgaaca
atgttcaaaccttttgaattagaatttgatgatgcaaattttcagattgatatattaatt
aatattctagaaatctattcagcaggaagttctcaaaaaattttaatggaattgaagaaa
tgtgagagctggaatgaaagattcaatattttcgctaaacaattctcaactatatatcca
tatctctcatttgcaaatttaaagacgctgtgtacaacgatttacaaacatttatccctt
cttcggcaatatgatccttatacattaccacctattaagtctcccataatattgctaaaa
tgtacgcactcatcaaatatgattgcgatcgaagaagatttttgtttgcataaggtaact
caaaatgtggtaaaagtacattacattgaaggtgatcatgtgacaatcttgaaaaataaa
aaagtagcagctgctattaacggagaattaccatttacaatttaa

DBGET integrated database retrieval system