KEGG   Atta cephalotes (leaf cutting ant): 105622284Help
Entry
105622284         CDS       T04923                                 

Definition
(RefSeq) pyrimidodiazepine synthase-like
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
acep  Atta cephalotes (leaf cutting ant)
Pathway
acep00480  Glutathione metabolism
acep00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:acep00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    105622284
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    105622284
Enzymes [BR:acep01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     105622284
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin GST_N_4 GST_C_3
Motif
Other DBs
NCBI-GeneID: 105622284
NCBI-ProteinID: XP_012059094
UniProt: A0A158NNI6
LinkDB All DBs
Position
Unknown
AA seq 242 aa AA seqDB search
MSAKHLSTGSVPPPVVPGKIRLYSMRFCPYAQRIHLVLDAKQIPYDVVYVNLTHKPDWLM
EKSPLNKVPCIELEEGETLYESLIIAEYLDDTYPQNKLYPNSSLAKAKDKLLIDRFNAVI
ATMYKGYSETALVQDVFNEVLTGLELFDRELAKRGTPFFGGSKPGMLDLMIWPWCERADV
IRIIKGEQYVLPRDRFLRLLEWRIAMKEDPAVSGSFLDAEMHAQFMRSRLVGTPQYDLIA
NS
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgaagcatttgagtactggatcggtaccaccgcccgtcgtgcccggaaaaata
cgcctgtacagcatgcgtttttgtccgtacgcgcaaaggattcaccttgtgctggatgct
aagcaaattccatatgatgtagtttatgtgaatttaacacacaaacctgactggttgatg
gaaaagagccctcttaataaagttccttgtattgaactggaagaaggagaaacattatat
gaaagtctaattatcgctgaatacctggatgatacatatcctcaaaataaactatatcca
aatagttctttagcaaaggctaaagataagttattgatcgatagatttaatgcagtgata
gcaactatgtataagggatattcggaaacagcactggtgcaagatgtattcaacgaggtg
ttaactggcttagaactctttgatcgggaattggcgaagagagggactccctttttcgga
ggcagcaaacctggtatgttggacttaatgatatggccgtggtgcgaaagggcagatgta
ataagaattataaagggagagcaatatgtcttacctcgagatcgtttcttacgactgctt
gaatggagaattgctatgaaagaagatcctgcagtgagtggcagcttcctggatgctgaa
atgcatgcccagttcatgcgtagtcgtctagttgggacacctcagtacgatttaatagct
aacagctaa

DBGET integrated database retrieval system