KEGG   Atta cephalotes (leaf cutting ant): 105622474Help
Entry
105622474         CDS       T04923                                 

Definition
(RefSeq) probable histone-lysine N-methyltransferase CG1716
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
acep  Atta cephalotes (leaf cutting ant)
Pathway
acep00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:acep00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    105622474
Enzymes [BR:acep01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105622474
Chromosome and associated proteins [BR:acep03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105622474
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW
Motif
Other DBs
NCBI-GeneID: 105622474
NCBI-ProteinID: XP_012059283
UniProt: A0A158NP25
LinkDB All DBs
Position
Unknown
AA seq 1836 aa AA seqDB search
MARRRKTEVKASEKSSHKYIPVRKSSRQIAKKQLEEKKINGYITQTSHSNSSEEFKSTSE
GHSQVLSKKNQNSLKKHNKCKGTSSDSVIVNSEYALYNAIQHKRDMGESDSQDDMDNMIK
NSEKLSPEDVQQVVIGNPSLSNESLPASTPASTKAETWSEEVIEEMIICEEMQVEQDVGD
NHYSLAQSDVIVEEVLLENESNLENKNFVEFTVIQNEDGNESRISKSEKILNTEYHAIKK
NVINSVHMNKSENSISAIHTELITSCNSGNNNATDSNTDKSYINKKKVLLEGGSSKKQKK
TIYDKITKEISESMASKIYLCSTKDDSGSSTEEDNCKRECKDLEAKNMNINLSKEDSFNK
IGNKLANMQISESSQEIQKLVNDLSSVESADSLIQTPLNMEKLSPVQLNIDDESSSSILD
KMEQLHRSNDSVNSNDKEIFSKTVEPNNIIKNQEQNILESNSCIDRLQCTDRVSLKSKIT
QDKKNTSQQKNSEYLTTTDEYQDSEGDNNKVDNEDIKLCSSSENSNDTLSSLTNYKGREF
DIKNAINNTNDIDKKMEFRGRSGSTDTSSENSSNSSGVRRSSRIRSIGLMKQRSRGRGLV
TKPNIDTSKTILQQEKEKVVNNTNSSIIQEVKIDNFETQCDKENNSNKISTSIDTLTPLS
TSYNTTGYDSDSSKPVKVKSRWRRSSELEMGGSNAGFGSIIAPMSMLGSSITLQSESGRN
ASINIGESTSSELKYNAVNTSIKFCTEIGQIKDVPVISSNVSTISTVAQIPKTIGAKILL
PMVLETEDREMEERLSQFEHLYENLYLTERYTNKETKRMVCDCFLTEEEIERGELGCGED
CLNRLLMIECGPRCVVGDRCTNKRFQNCQYAKCEVFRTEKKGFGLRAVVDIMAGEFIMEY
VGEVVDPKDFRRRAKEYSKDKNRHYYFMALKSDQIIDATMKGNISRFINHSCDPNAETQK
WTVNGELRIGFFNKKFIAAGEEITFDYHFQRYGKEAQKCYCEALNCRGWIGDTPEEEKEK
IEKKETEERDTKKKMEEKKPADDYMEDEDLEEEIDKLCSGGLKNRAHTLTLSRLMVRSRE
LEHRTRLLRLIQSGEQPCRRLFLDYHGLRLIWSYVMDIGTNESEEAQQFRLDVLKTLNTL
PIPNKTMLMDSKIYGVIERWAKKLYLSPNTDSPEDDQIKSKMSCEELNSNSDSSEKKSLD
ERLNDIPDKSNNNIESCLAVVSEVKSENTDLIPDLASSLLAEWSNLKEVFRIPKKERIEQ
MKEHEREADRGYREELEKEEEKRITSYDRHRSDRYSRSDIDKRGDRRRGRESPETDHSRT
DHNRTKDKRVEERSLVPIPRMTKYERRQLFALQVAKEEEERQRRQQQESWQEHENRCLAL
GIDPHTTAMVDPQTGYPVFYNPTLGQWQHYSTQDGGEATQQCTPVYVGSAPSTGIIGQSP
HVLSSSITNDMSSGITTGIPPGVAYSLSQTPVFSQTSSYSLISHPQPYTEGQLPLSNSLV
FVLYGISSTSIKTFLHNYIKNSADQQFSNLTSAENVTSRPQPEVPAIDLPPKWKSATDSR
GRTYYYHVKERISQWLPPPPDHIGVQPDSSSTSESSDESSSSNEDDEDIDDDHNEDQRND
DMEASSVLTDSPLNTSRPNVSKKLSGHNLTGSSLPFPESKKRRDGLVQERIISPRREDDR
LDHKIYKEMKDKLRRQKERTKLKDHVEKLRKHRRSNKSKSYSRHGMNKLQSTSAEVSPMS
ERKIKDTFRINMANVMVHFLNPYRKNDCKQGRITNTEDFKHLARKLTHFVLAKELKHCKS
VDELQCNENVKHKARDFVRKYMSKFGAVYQKGTDED
NT seq 5511 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcagacgtaaaaccgaagtaaaagcatctgagaaatcatctcataaatatata
cctgtacgtaaatctagcagacaaatagctaagaagcaattagaagaaaaaaagataaat
ggatacatcacgcaaacatctcactcaaacagttcagaagagtttaagtctactagcgaa
ggtcatagccaagttctttcaaagaaaaatcaaaattctctgaagaaacataacaaatgt
aaaggtacttccagcgacagtgtaattgtaaatagtgaatatgctttatacaatgctatt
caacataaacgagatatgggtgaaagtgacagtcaagatgatatggataatatgattaaa
aattcagaaaaacttagtccagaggatgtacagcaagttgttattggtaatccaagtcta
agcaatgaatctttacctgcatctacacctgcatcaaccaaggctgaaacgtggtcagaa
gaggtcatagaggaaatgataatctgtgaagaaatgcaagtggagcaagatgttggtgac
aaccattattctttggcacagagtgatgttatagttgaagaggtattacttgagaacgaa
tctaatctagaaaacaaaaattttgtagaatttactgtgatacagaatgaggatggtaac
gaatccaggatatctaagtcagaaaaaattttgaacactgaatatcatgctattaaaaaa
aatgttataaatagtgtacatatgaataaatcagaaaattccatatcagccatacatact
gaattgataacttcatgcaatagtgggaataataatgccacagattctaatacagataaa
tcttatatcaataaaaagaaagttttattagaaggtggaagtagtaaaaaacaaaaaaag
acaatttatgataaaattacaaaggaaatttcagaatcaatggccagcaaaatttattta
tgttccactaaagatgattctggttcttctactgaagaagataactgcaagcgggaatgt
aaagacttagaagcaaaaaatatgaacataaatttgtcaaaggaagattcttttaataaa
ataggtaataaactagcaaatatgcagattagtgaatcttcacaagaaatacagaaatta
gtgaatgacctgtctagtgtggaaagtgctgattctctgatacaaactcctttaaatatg
gaaaaattgtctccagtacaactaaatattgatgacgaaagtagttcgtcaatactggat
aagatggagcagttacatcgctcgaatgattctgttaattctaacgataaggaaatattc
tcgaaaactgtagaacctaacaatattattaaaaatcaagaacaaaatattttagaatcc
aattcttgcattgatagacttcaatgtacagatcgagtttcattaaaatcgaaaattaca
caagacaagaagaatacaagtcagcaaaagaattcagaatatttaacaactactgatgaa
tatcaagatagtgaaggagataataataaagttgataatgaagatattaaactatgcagc
agcagcgaaaatagtaatgatacattgtcatcccttactaattacaaaggacgagaattt
gacataaaaaatgcaattaataatacgaatgatattgataaaaaaatggaattcagaggt
cgtagtggaagcactgatacaagttctgaaaatagttcaaatagttcaggcgtaagacga
agtagtagaattcggtctattggattgatgaaacaaagatctcgcggacgtggtttggtt
acaaaacctaatatagacacttcaaaaactattcttcaacaagaaaaagaaaaagttgtt
aataatacgaattcttcaattattcaggaagtaaaaatagataactttgagactcagtgt
gataaagaaaataattctaacaagatttcaacatcgattgatactttaacacctttaagt
actagttataatactacaggatatgattctgactcttcaaaaccagttaaagtaaaatcc
cgttggcgaagatcgagtgagcttgaaatgggtggatcaaatgcaggatttggatctatc
attgccccaatgtcaatgcttggatcatctattacacttcaatctgaatcaggacgtaat
gcatcaataaatataggagaatctacgtcatcagaattaaaatataatgctgttaataca
agtataaaattttgtacggaaatagggcaaattaaagatgtaccagtgatatccagtaat
gtttctactatttcaacagtagcacaaattccaaaaactataggagcaaagattttgttg
ccaatggttctcgaaacagaagatagagaaatggaagaaagactgagtcagtttgaacac
ttgtatgaaaatttgtatcttacagaaagatatacaaacaaggaaaccaaaagaatggtt
tgcgattgtttcttaactgaagaagaaattgagagaggagaacttggttgtggagaagat
tgccttaatagacttctcatgatagaatgtggacctagatgcgtagtaggtgatagatgt
acaaataaaagatttcaaaattgtcaatatgccaaatgcgaagtttttcgaacagagaag
aaaggttttggattacgtgctgttgttgacataatggcgggcgaatttataatggagtat
gtaggtgaagttgtagatccaaaggattttagacgtcgagcaaaagaatactccaaagat
aaaaacagacattactattttatggcgttgaaatctgatcagattatagatgctacgatg
aaaggaaatatatcccgattcattaatcacagctgtgatccaaatgcggagacgcaaaaa
tggacggtaaatggggaattacggataggcttttttaacaaaaaattcatagctgctggc
gaagaaattacatttgactatcattttcaacgttatggcaaagaagctcagaagtgttat
tgtgaggcactgaattgtcgaggttggataggtgatacaccagaagaagagaaggagaaa
attgaaaagaaagaaacagaggaaagagatacgaagaagaaaatggaagaaaagaaacca
gctgatgattatatggaagacgaggatttggaggaagaaatagataaattgtgttcaggt
ggtttgaaaaaccgtgcgcacactttaacattaagtaggttaatggttcgtagcagagaa
ttagaacatagaacacgtttgttacgtcttattcaaagtggtgaacaaccatgtcgaaga
ttgtttttggattatcatggattacgtttaatttggagttatgttatggatattggtaca
aacgaatcggaagaagctcaacaatttcgcttagatgtgctgaaaactctaaatacactg
ccaataccaaacaaaacaatgttaatggatagtaaaatatatggtgtaattgaaagatgg
gcgaaaaaattatatctttctccaaatactgattctccagaagatgatcagattaaatca
aagatgagctgtgaagaattgaatagtaattctgatagcagtgagaaaaaaagtcttgat
gaacgtctaaatgacattccagataaaagtaataacaatatcgaaagttgtttggcagtt
gttagcgaagtcaaatcagagaatacagatcttatccccgatttagcttctagtcttctt
gctgaatggtctaatttaaaagaagtttttagaataccgaaaaaagagagaattgagcaa
atgaaggagcatgaaagagaagcagatcgaggatacagagaagaattagagaaagaagaa
gaaaagagaatcacgtcgtatgatagacatagatctgatagatatagtcgaagtgatata
gacaaacgtggtgataggagacgaggacgagaatctccagaaactgatcatagtagaact
gatcataatagaacaaaagataaaagagtagaagaacggagtctagttcctataccacga
atgacaaagtacgaacgtaggcaattatttgcattgcaagttgcaaaagaagaagaagaa
aggcaacgtcgtcaacaacaagaatcgtggcaagaacatgaaaatagatgtttagcattg
ggtatagatccccatactactgccatggttgacccacaaactggttatcctgttttttat
aatccaactctaggtcaatggcaacactattccactcaagatggtggagaagcgacacaa
caatgtactcctgtatatgtaggaagtgctccatctactggtataataggtcaaagtcct
catgtattatcatcatcaataacaaatgatatgtcgtccggaattacgactggtattcca
cctggtgtagcttactcattaagtcaaacgcctgtgttcagtcaaacatcttcttattct
ttgatatcgcatccgcaaccatataccgaagggcaactacctctttcaaacagtttagtg
tttgttctttatggcatttcttctacatcaattaaaacgtttcttcataactatatcaaa
aattccgcagatcaacaattctctaatcttacgtccgcggaaaatgtcacgagtcgacca
caacctgaagttccggcaatagatttgccaccgaaatggaagagtgcaacggatagcaga
ggtagaacatactattatcacgtgaaggaaagaatatcgcaatggttacctccaccaccc
gatcacattggagtacagccagattcgtcatctacctcggaatctagtgatgaatctagt
tcatcaaatgaagatgatgaagatattgatgatgatcataatgaagatcaaagaaatgat
gatatggaggcaagtagcgttctaacagacagtcctttgaacacatccaggccaaatgta
tctaaaaaattaagtggtcataatctgactggaagttcactgccgtttcccgaatctaag
aagagaagagatggattggtccaagaaagaattattagtccacgtagggaagatgatcgt
cttgatcataagatatataaggaaatgaaagataaattacgacgacagaaagaaaggaca
aaattaaaagatcatgttgagaaattaagaaaacatagacgaagtaataaatcgaagtct
tactcgcgacatggaatgaacaagttacaatcaacatcagctgaggtgtctcctatgtca
gaaaggaaaattaaagatacatttagaataaacatggctaatgtgatggttcacttctta
aatccatataggaaaaatgattgcaaacaaggtagaataactaatactgaagatttcaag
catctagctagaaagttaacacattttgtacttgcaaaagaattaaaacattgtaaaagc
gtggacgaattacaatgtaatgaaaatgttaaacataaagcaagagattttgtacgtaag
tacatgagcaagttcggggcagtgtatcagaaaggtacagacgaggattag

DBGET integrated database retrieval system