KEGG   Atta cephalotes (leaf cutting ant): 105622622Help
Entry
105622622         CDS       T04923                                 

Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
acep  Atta cephalotes (leaf cutting ant)
Brite
KEGG Orthology (KO) [BR:acep00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:acep03036]
    105622622
Enzymes [BR:acep01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     105622622
Chromosome and associated proteins [BR:acep03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     105622622
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 105622622
NCBI-ProteinID: XP_012059428
UniProt: A0A158NPH0
LinkDB All DBs
Position
Unknown
AA seq 1072 aa AA seqDB search
MALDYDTTTYNMHHTNQLEDVGYRSVEITSAFTHLPQKEMARDTPGSPMPRPRDLGAGGG
GSAATATLTSGTYHTAAADTTNIHGQHALQQKILELQQHHQLQQQILRQQYHAQERQLAE
LHEQQMHQLKLWEQQKQLEEQRREKERLEALRKKDKHDHSANASTEVKERLHSFLVNKKQ
REAAAAANGAVPGTPGYRNWLQPQSESSSTTNAAHPYQMPQMLQKFGDDFPLRKTASEPN
LLKVRLKQRVERNMAASRNSPLMARRKDRLASHLKRKSLLANSGSNPESGPNSPPTVNNS
QASPTAGSNTAIQEEGENSAYGGRLTSSSQQGSFSDLSLFSSPSMPNISLGRPHVPSSSS
SGTKLAPVSEAEVRAAFTARLGMPLTGQMLHGTLPFYPSLTVIEGEPAYIHKQIQQNLQE
QASPSATVSGSRQHPAMAAAVYHTAAPITDTQVAQARLQKAGHHRPLGSRTQSAPLPLGH
PMLQSGIIAPPTHYEEYLAEKQLHDQQQAHNYLKQQIRQTVLTRVGSRGQTNQLDEAPES
EESEVIDLTGKKDHPEESEISKQTRGREQFLQQQRDLMMRHTLQTNESTIYAGGLSRTSQ
SARPLSRALSSPLVHLGPQSSDIFARGSSHRPTTGLAYDPLMLKHACVCGETVRGHPEHG
GRLQSVWARLSETGLLQRCDRIRSRKATLEEIQTCHSEAHALLFGTNPLNRQKLDMSKLS
QLPIKSFVRLPCGGVGVDSDTTWNELNTAPAARMAVGCVVDLAFKTAVGDIKNGFAVVRP
PGHHAETNQAMGFCFFNSVAIAARLLQQKLDVRKILILDWDVHHGNGTQQMFYDDPRVLY
LSIHRHDDGNFFPGTGGPTECGAGKGLGYNVNVAWSGGLNPPMSDAEYLAAFRTIVMPIA
KEFDPDIVIVSAGFDAAVGHPAPLGGYKVSPACFGRMTQHLLNVADGKVVLALEGGYDLA
AICDSAQECVRALLGDELSPLRDEELTRIPCQNAIDTLQKTIAIQMSHWPCVKLAAHTVA
MSAIEASQKEHDETETVSAMASLSMQQPTNLTTTPEHSREVSEEPMEQDEAK
NT seq 3219 nt NT seq  +upstreamnt  +downstreamnt
atggccctggactatgatactaccacatacaatatgcaccacacgaatcaactagaagac
gtgggctatagaagcgttgaaattacatccgctttcacgcatctgcctcaaaaggagatg
gccagagacacgccgggctctccgatgccgcgaccgcgagatttgggcgccggtggcgga
ggaagcgcggccacggctaccttgacttccggcacttatcacactgcagctgccgatact
accaacatacatggccaacatgcactgcagcagaagatactcgagctacagcagcatcat
caacttcagcaacagattctccggcaacagtatcatgcccaggaacgacaattggctgaa
ctgcatgagcaacagatgcatcaattaaagctctgggaacagcagaagcagttggaggaa
caaaggcgagagaaagaaagactcgaggctctcaggaagaaagacaagcatgatcatagc
gcgaatgcatccacagaagtcaaggaacgccttcatagttttctggtgaataaaaagcaa
agggaggcagctgctgcggcgaacggagcagtacccggtacacccggatatagaaactgg
ttacaaccgcagtcagagtcatcgagcaccacgaatgcagctcatccatatcagatgcca
caaatgctgcagaagtttggcgacgatttcccgcttagaaagacagcttcggagccgaac
ttgctgaaagtgcgactaaaacaacgcgtggaaaggaacatggctgcgtcgagaaactca
cctttgatggcacgccggaaggaccgcctggcgtcgcatctcaagcggaaatcgttatta
gcaaattctggcagcaatcctgagtctgggcctaattctcctccgactgtcaataattct
caagccagtcccactgctggaagcaatacagcgatacaggaagaaggtgaaaattcagca
tatggaggacgtctcactagcagtagtcaacaaggcagcttttcggatctttcgcttttc
agttcaccgtccatgcctaacatctcgttaggtagacctcatgtaccgtcgagctcatca
agtgggacgaaattggcgccggtctcagaagcggaagtgcgagctgcgttcacggcgcgt
ctcggcatgccgcttaccggtcagatgctgcacggtaccttaccgttctatccatccctg
acggttatcgaaggcgagccggcatacatccataaacaaatacaacagaatctacaagaa
caggcatcgccgtccgcgacggtgagtggcagcaggcagcatccagcaatggcagcagca
gtgtatcataccgcagcaccgatcacggatacacaagtagcgcaagcaagactgcaaaag
gctggtcatcaccggcctttaggtagtagaacccaatccgcgcccttaccattaggtcat
ccaatgctacagagcggcataatagcaccgcctacgcattacgaagaatatctcgcagag
aaacagttgcacgatcagcaacaagcgcacaattatttgaaacaacagatccgtcagact
gtcctgacgcgagtaggctcgcgcggtcaaaccaatcagttggatgaagcaccagagtcc
gaagaatccgaagtaatagatctcacgggtaagaaagatcatccggaggagagcgagatc
tcgaagcagacgagaggccgtgaacaatttcttcaacaacagagagatcttatgatgagg
cacacattgcagacgaatgagtcgaccatctacgccggaggtttaagcagaacttctcag
tcagctagaccactttctagagcattgtcgagtcctctagtacatctaggtcctcagagc
agcgatatttttgcacgaggttcttcgcatcgacccactacgggattagcttatgatcca
ttgatgttgaaacatgcatgtgtctgtggcgaaacggtcagaggtcatcctgaacatggt
ggccgattgcagagcgtatgggctagattatcagaaacgggcttgttgcaacgttgcgac
cgaatacgctcgcgcaaggccacactcgaagaaattcaaacatgtcatagcgaagctcat
gcacttttatttggaacgaatccgttgaatcgacagaaactggatatgtccaaactatcg
caattgcctatcaaaagtttcgtccgacttccctgtggtggagttggagttgattccgac
acaacgtggaacgagcttaatactgcacctgctgctcgaatggcagtgggatgtgttgtt
gatcttgcattcaagacagcagtgggtgatattaagaacggctttgctgtggtaagaccg
cccgggcatcacgcagagactaatcaagccatgggtttctgcttcttcaactcggtggca
atcgcagcgaggctacttcagcagaaactcgacgttagaaaaattttaatcttagattgg
gatgttcatcatggaaacggtactcaacagatgttttatgatgatccacgagtgctgtac
ctgtcgatacatagacacgatgatggtaatttcttccctggaaccggtgggcctactgaa
tgcggtgctggcaaaggtctcggttacaatgtaaacgtggcatggtcaggtggcctgaat
ccgcccatgagcgacgcggagtatctcgcggcatttcgtacgattgtcatgccaattgct
aaggaattcgatccagacatcgtgatcgtctcagctggtttcgatgctgctgttggtcat
ccggcgccattgggtggctacaaagtcagcccggcatgcttcggtagaatgacacaacat
ttacttaatgtggctgatggcaaagtcgtccttgccttggaaggaggatatgatttagcg
gcaatctgcgattcggcacaagagtgcgttcgagcgttgcttggtgacgaactcagtcct
ctccgagacgaagaacttacgagaattccttgccaaaacgccattgatacgctgcagaag
accatcgctatccagatgtcacactggccttgcgtaaagctcgctgctcatacagtcgca
atgagcgctatagaagcgagtcagaaggaacacgacgaaacagaaaccgtgtctgcaatg
gcctctctatcaatgcagcagcctacaaatctcacgaccacaccagaacattcccgagag
gtctccgaagagccaatggaacaggacgaggccaaatga

DBGET integrated database retrieval system