KEGG   Atta cephalotes (leaf cutting ant): 105622872
Entry
105622872         CDS       T04923                                 

Definition
(RefSeq) tripeptidyl-peptidase 2
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
acep  Atta cephalotes (leaf cutting ant)
Brite
KEGG Orthology (KO) [BR:acep00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:acep01002]
    105622872
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:acep03110]
    105622872
Enzymes [BR:acep01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     105622872
Peptidases and inhibitors [BR:acep01002]
 Serine peptidases
  Family S8: subtilisin family
   105622872
Chaperones and folding catalysts [BR:acep03110]
 Intramolecular chaperones
  Subtilisin family
   105622872
SSDB
Motif
Pfam: TPPII Peptidase_S8
Other DBs
NCBI-GeneID: 105622872
NCBI-ProteinID: XP_012059674
UniProt: A0A158NQ66
LinkDB
Position
Unknown
AA seq 1194 aa
MADVIDCNFPVWGLLPKKETGVTQFLTKYPEYDGRGVVIAILDSGVDPGAPGMQVTSDGK
PKIIERFDCSGAGDVDTSKVVQAPDGYITGLTGRKLKVPSNWNNPGGEYHIGLKNLYSLY
PNKLKERVVAERKKRLWDDGHKAALAEASRQLQEFENKNPQLSTLEERLQKEEFEARVEV
LNNIEKKYCDVGPTYDCVVFHDGNIWRACIDTSEVGNLETGVFLGEYSITRDFAPLTQED
QLNISINIHDEGNTLEIVSLCSSHGTHVASIAAAYFPDNPELNGVAPGAQIISLTVGDGR
IGTMETGTSVVRAMIHIMQRKEKIHVINMSYGEHAHWSNTGRIGELMNEVIDEYGVIWVA
SAGNLGPALCTIGTPPDISSNSIISVGAYVSPDMMVAEYSLREKMPGMPYTWSSRGPMID
GGAGVTVCAPGGAITSVPNFTLRKSQLMNGTSMASPHVTGAVAVLVSGLLAKGSLYSPYS
IKRALENTALYVPNLDPFAQGSGLLQVERAFDNLISCCDAPERDVRFAINCGVNNSKGIH
MRTGVIDRAKDFAITVEPVFINSENIDPARKIDFNLKLTLVCDASWVQFPTHLDLMHMPR
AFAIRVDATNLPEGVHATSVRAYDVTNIAKGPVFQIPVTVVQPMTISKTALLPDLTYTNV
LFKPNTIQRHFILVPEDATWAVLRLKSTEKDKTGRFVMHIIQLKPRLACKTLEVNRIISV
TSQSETVQPFAVQGGLILEVVIAKYWANLGDMFIDYSIEFHGIHMINGNLTMLSGDGINR
LELRSSLRNEEIVPNISLKTSVQVLKPNESKIAPLRTRDIIPPSRQIYELQLTYTFHSAK
STEVTPNAALLSDLLYESEYESQMWMIYDSNKQLISCGDAYPSKYTIHKLEKGDYTLKMH
IRHEKKDLLERLTDMPLLLSQKLSTPINLDIYANQSQAIIGGKKMVAACIPPGHILPLYI
APLSNESKLAPSIKPGDHTNTLYGELKGAFSDHLPVHTAMLISLDSSEARRHVPQNDLSE
NAIAFANQIITVADSVITNIDQDKLLAYYGLKNDQRPDAAKIKVTMEKQKNSLIEGLVKK
GCALARLYVHGTKTGEGDGSFEHLLESVTHHWQEVQKFAEPTDNKVIILSLWHAHINNHY
GRYLKLLTRYYEEKQLKEIDEKCIEIAKLLGWEHWSRLLTTSIPTRYPATYRSF
NT seq 3585 nt   +upstreamnt  +downstreamnt
atggcagacgtcatcgattgtaactttcctgtttggggcctgctgcctaaaaaagagaca
ggtgtcactcagtttcttactaaatatccagagtacgatggacggggtgttgtcattgcg
atactggactcgggggtggatcccggagctccgggtatgcaggtgacttcagatggaaaa
cccaaaattattgagagatttgactgtagcggagcaggggatgtagacactagcaaagtt
gttcaagcacctgatggatatataactggcctgactggtcgtaaattaaaggttccatct
aattggaataatcctggtggagaatatcatatcggtttaaagaatctgtattcattatat
cctaataaactaaaggaaagggtagtggcagaacgcaagaagcgtctttgggatgatgga
cataaagcagcacttgcagaagcctccagacaattacaggaatttgagaataaaaatcca
caattatcgactttggaagaaagactgcaaaaagaagagtttgaagctcgagttgaagta
ttgaataatattgaaaaaaagtattgcgatgtaggacctacttacgattgcgttgttttc
catgatggtaatatttggagagcatgtattgatacttctgaagtgggtaacctggaaact
ggcgtttttcttggtgaatattctatcacgagagattttgctcctcttacacaagaagac
cagttaaatattagtattaatattcatgatgaaggcaatacattagaaattgtcagctta
tgctcgagtcatgggacacatgtcgcatcaatagcagctgcatattttcctgataatcca
gaattgaatggagtggcaccaggagcccaaattatttcacttactgtcggtgatggtcgt
attggcacaatggaaactggaacttcagtagtgcgggcaatgatccatataatgcaacgt
aaagagaagattcacgttataaacatgagttatggtgaacacgctcactggtcaaataca
ggtagaataggagaattaatgaatgaagttattgatgaatatggtgtaatatgggttgca
tctgctggcaatctgggcccagctttgtgtactattggaactcctccagacatcagttca
aacagtattattagtgttggtgcttacgtatcacctgatatgatggtagccgaatattct
ttaagagaaaagatgccaggcatgccatatacttggtcctcccgtggtccaatgatagat
ggaggtgctggtgtaacagtatgtgcaccaggaggtgccattaccagcgttccaaatttt
actcttagaaaaagtcaacttatgaatggtacgagtatggcaagtccacatgttactgga
gcagttgcggttcttgtatcgggtcttcttgccaagggttctttatattctccttatagt
ataaaaagagcacttgagaatactgctctttatgtacctaatttagatccatttgcacaa
ggctctggcctattacaagtcgaacgtgcatttgataatctcatttcgtgttgtgatgca
cccgaaagagacgtacgttttgctatcaattgcggcgttaataattctaaaggcattcat
atgagaacaggtgtcattgatcgtgcaaaggattttgcaattacagtcgaaccagtattt
ataaatagcgaaaatatagatccagcacgcaaaatagattttaatctgaagctaacactg
gtgtgtgatgcttcctgggttcaatttccgacacatctagatttgatgcatatgcctcgt
gcttttgctattagggttgatgctactaatttaccagaaggtgttcatgctactagtgta
cgagcgtatgatgtaactaatattgcgaaaggaccagtatttcaaattccggtaactgtt
gtccagccaatgacaatatcgaagactgcacttcttccagacttaacatacacaaatgta
ttatttaaacctaatacaattcagcgtcattttattcttgttccagaagatgctacttgg
gcagttctcagattaaaaagcacagaaaaggataagactggtagatttgtgatgcacatt
attcaattaaaacctcgtttagcttgtaaaactcttgaagttaacagaataataagtgtt
acatctcaatcggaaactgttcaaccatttgctgttcagggtggattaattttagaagta
gttatcgcaaagtattgggcaaatcttggcgatatgtttattgattattctatagaattt
catggaattcatatgataaacggtaatcttacaatgctatctggagatggaataaatcgc
cttgaattacgtagttctcttagaaacgaagaaattgtacccaacatttctctgaagaca
tctgttcaagtcttaaagcctaatgaatcgaaaattgctcctttacgaacacgtgatatt
attccaccatcacgacaaatatatgaattacaactaacatacacattccactcggcaaaa
tcaactgaggtcacaccaaatgcagcattgcttagtgatttattgtatgaaagcgaatat
gaaagccaaatgtggatgatttatgacagtaataaacaattgataagttgtggagatgca
tatccatctaaatatacaattcataaattagaaaagggagattacactttgaaaatgcat
atacgtcatgagaaaaaggatttgttagaaagattgacagacatgccgttactattgagt
caaaagcttagtacaccaattaatttggatatttatgccaatcaatcgcaagccattatt
ggtggaaaaaaaatggttgctgcatgtattccacctggccatattcttcctctgtatatt
gctccactgtctaatgaaagcaaattagcaccatcaataaaacctggtgatcacaccaat
acgttgtatggagaattgaagggtgccttctcagatcatttgcctgtccacactgccatg
ttgatatcattggattcttcggaggcacggcgacatgtaccacaaaatgatctttcagaa
aacgctattgcgtttgctaatcaaataataacagttgctgactctgtgatcactaatatt
gatcaagataagttattagcatattatggattgaaaaacgatcaacgtcctgatgcagct
aaaatcaaagtaactatggagaagcaaaaaaacagtttgattgaaggattagtgaaaaaa
ggctgtgcattggcacgtttgtatgtacatggaacaaagactggggagggagatggatct
ttcgaacatttgcttgaaagtgttacacatcattggcaagaagtacagaaattcgctgaa
cctactgacaataaggttattattttatctctatggcatgcacacatcaataatcattat
ggacgttatttgaaattattgacacgctattatgaagaaaaacaattaaaagaaattgat
gaaaaatgcattgaaattgcaaagcttctgggatgggaacattggtcacgtcttcttacc
acaagtataccaacacgttacccagctacatatagatcattctga

DBGET integrated database retrieval system