KEGG   Atta cephalotes (leaf cutting ant): 105623984Help
Entry
105623984         CDS       T04923                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
acep  Atta cephalotes (leaf cutting ant)
Pathway
acep00052  Galactose metabolism
acep00500  Starch and sucrose metabolism
acep01100  Metabolic pathways
acep04142  Lysosome
Brite
KEGG Orthology (KO) [BR:acep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105623984
   00500 Starch and sucrose metabolism
    105623984
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    105623984
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acep04147]
    105623984
Enzymes [BR:acep01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     105623984
Exosome [BR:acep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105623984
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110 DUF1154
Motif
Other DBs
NCBI-GeneID: 105623984
NCBI-ProteinID: XP_012060744
UniProt: A0A158NT86
LinkDB All DBs
Position
Unknown
AA seq 1033 aa AA seqDB search
MANVEINRQDVSEKSRYYSATKERPNKIMEKFNTIVVKTLNNKFYEPSIKKHEKEESNLD
KRHNVKRTIMTLFLGLITALLLFHLGLPLLYAIINPLRTINSYNAEVEFMIDINNDTIEE
TRYQHILVDTPDIYIEQETYDRKIVPLKEENTAFNNAQQCSNVPEILRFDCHPEDGASQL
SCINRGCCWNPRENNKNEKDILLYIPYCYYPDGWNLYKYINRSQDGNNFLGFLSQEKKSV
YKNNVPLVKVEATGINSSILRVKIYDPFKMRYEPPWPIRSDPKPFLYQVVDTKYQFNSDD
IKPGFKVNRISDGTTLFNSIGIGGFIFADQFLQISSLLPTSNIYGIGGHQSSLKLNINWQ
IFTLFNKDQPPMENANLYGSHPFYIIMEESGMAHGVLFLNSNAMDVILQPTPAITFRTIG
GIFDIYFFLGPTPADVVKQYSEIVGKPFMPPYWSLGFHLCRYGYESLENTKAVWSRTRTA
GIPFDTQWNDLDYMDKNNDFTYNKEKFKDLPKFVEEIHSAGMHYIPLIDAGISASEDNGS
YLPYDEGIKQDIFIKDGESDKPFIGKVWNLFSTVWPDFTNPKTMIYYTNMMSDMHNNFAY
DGTWIDMNEPSNFYNGNKNGCTHNNLDYPEYIPNVVGGLLATKTLCMNAKHYLGTHYNLH
NTYGMSQAITTNYALRKIRLKRPFIISRSTWIGHGHYAGHWTGDVYSSWHDLKMSIPAIL
SFNFYQVPMVGADICGFNGNTTTALCNRWMQLGAFYPFSRNHNSDNTIEQDPVAMGDLVV
QSSKNSLKIRYRFLPYLYTLFFRAHKFGETVVRPLFFEFIEDRRTYDIDKQFLWGNSLMI
NPVLEENKIAVTVYVPRGLWYDYYTFNSYFSIGKYYTFPAPIDKIPLLIRAGSILPAQDP
GVTTTESRKNNFELIVTLNETKNAIGELYWDDGDSLDSIKKKEYLWLSFIANQSSLLNME
MDKSSFNEEVILGTVQIFGLRPVTTVFLNSNEIGFSFNLSTSSLHITGLQVDMRQPFIFN
WIFEESIFNINYT
NT seq 3102 nt NT seq  +upstreamnt  +downstreamnt
atggctaatgtagaaataaatagacaggatgtttctgaaaaatcaagatattacagtgca
actaaagaacgtccaaacaaaattatggagaaatttaataccattgtagttaaaacatta
aacaataaattctatgagccatcaataaaaaaacacgaaaaagaagagtcgaatcttgat
aaacgtcataatgtaaaacgtacgataatgacattattcttgggtctcatcacggcttta
ttgttgtttcatcttggtcttccattattatacgcgattataaatccgttacgtactata
aatagttacaatgcagaagtggaatttatgattgatataaataacgataccattgaggag
acaagatatcagcatatattagtggatactcctgatatatacatcgaacaagaaacatat
gatcgtaaaatagtgcctttgaaggaagaaaatacagcatttaacaatgctcaacagtgc
agcaacgttcctgaaatattacgctttgattgtcatccagaggatggagcatcgcaactt
tcttgcataaatagaggatgttgttggaatcctcgtgaaaataacaaaaatgaaaaggat
atattgttatatattccttactgttattatcccgatggatggaatctgtataaatatatt
aaccgcagtcaggatggaaataatttcttgggttttctcagtcaagaaaaaaaatctgtg
tacaagaacaatgtgcctcttgtcaaggtagaagccacaggcataaacagctcaattctg
cgtgtgaagatatatgatccttttaaaatgcgatatgaaccaccatggccaattagatcg
gatccgaagccatttttatatcaagttgttgacacaaaatatcaatttaatagcgatgat
ataaaacctggttttaaagtcaatagaatcagtgatggcacaacattattcaattccatt
gggattggaggtttcatatttgctgaccagtttctacaaataagctcattgttaccaaca
agtaatatttatggcattggcgggcatcaatcgagcttaaaattaaatattaattggcaa
atattcactctatttaataaagatcaaccaccaatggaaaacgcaaatctatatggatct
catccattttatattattatggaggaatctggaatggctcatggagttttatttttaaat
agtaatgctatggatgtgatactacagcctacaccggctataacgtttagaacaatcggt
ggtatttttgatatttactttttcctgggaccgactccagccgatgtagtgaaacaatat
tctgaaattgtaggcaaaccatttatgccaccctattggtcgctcggttttcatttatgc
agatatgggtatgaatcactggaaaatactaaagcagtatggagcagaacgagaacagct
ggaatcccatttgatactcaatggaatgatctggattatatggataaaaataatgatttt
acatataataaagagaaatttaaagatttacctaagtttgtagaagaaattcactcggca
ggaatgcattatatacctttaattgatgccggcatatctgcttccgaagataacggttct
tatctgccttatgacgaaggaataaaacaagacatatttataaaagacggtgaatccgac
aaacctttcatcggtaaagtttggaatcttttttctacagtatggcccgatttcacaaat
cctaaaactatgatctattatacaaatatgatgagcgatatgcataataattttgcgtac
gatggtacatggattgatatgaacgaaccatccaatttttataatggtaataagaatggt
tgtacacataataatttagattatcccgaatatattcccaatgttgttggcggtttactc
gctacaaaaactctttgcatgaatgcgaaacattatttgggcactcattataatcttcac
aatacttatggaatgagccaagcgattaccacaaattatgctcttaggaaaattagatta
aagagaccatttataatatcgcgttcgacatggataggacatggtcattatgcgggtcat
tggacgggtgacgtttattcatcatggcatgatttaaagatgagtattccagctattttg
tcattcaatttttatcaagttccaatggtgggcgcagatatttgcggttttaatggaaac
acaactactgcattgtgcaatcgttggatgcaacttggtgctttttatccattttctcga
aatcataattccgataatacaattgagcaagatccagttgctatgggcgatttggtcgta
caatcatcaaaaaattctctcaaaatacgttatcgatttttaccatatttgtacacctta
ttcttcagagcacataaatttggggaaaccgtggtacggccacttttctttgaatttatc
gaagatcggcgaacttacgatattgataaacaatttctttggggaaattcgcttatgatc
aatccagttctcgaagagaacaaaattgcggtaactgtttatgtaccacgtggtttgtgg
tatgattattataccttcaattcctatttctccatcggaaaatattataccttccctgca
ccgattgacaaaataccattattgattcgtgcaggttcgattcttccagcacaagatccg
ggtgtaacaacgacagaaagcagaaaaaacaattttgaattaatagtaacattgaatgaa
actaaaaatgctataggagaattgtattgggacgatggtgatagcttagattccataaaa
aagaaagaatatttgtggctgtctttcattgcaaatcaatcaagtttattgaatatggaa
atggataaaagttcttttaacgaagaggtaatattgggaacagtacagatttttggatta
cgaccagtcaccacagtattcctaaatagcaatgagataggcttttcatttaatctttcc
acatcgagcttacatattactggtttgcaagtagatatgagacaaccatttatatttaac
tggatatttgaagaatctattttcaatattaattatacgtaa

DBGET integrated database retrieval system