KEGG   Atta cephalotes (leaf cutting ant): 105625639Help
Entry
105625639         CDS       T04923                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
acep  Atta cephalotes (leaf cutting ant)
Brite
KEGG Orthology (KO) [BR:acep00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:acep01002]
    105625639
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acep04147]
    105625639
   04090 CD molecules [BR:acep04090]
    105625639
Enzymes [BR:acep01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     105625639
Peptidases [BR:acep01002]
 Metallo Peptidases
  Family M2
   105625639
Exosome [BR:acep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105625639
CD molecules [BR:acep04090]
 Proteins
  105625639
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 5_3_exonuc
Motif
Other DBs
NCBI-GeneID: 105625639
NCBI-ProteinID: XP_012062351
UniProt: A0A158NXU3
LinkDB All DBs
Position
Unknown
AA seq 636 aa AA seqDB search
MLRLILVAVVITLVAAKPTTEDADIKSETSDDLLKSAHELLKRIDAEYAKWNNIQSITAW
NYASNLTNENLAEKLKCSAEGANVTKHIIQIVNDFPWRDLKNESMKRQFKKLSILGVAAL
PEQSYNEFEMTVSKMENIYSTAKICDYHNKSKCDLALEPEIIEISKSSHDPEELKHIWVE
WRKVSGEKVKSLYSKYVELANTVATLNNFSDYAAFWMKDYEADNFPEQIETQWQQLKPLY
LQLHAYVRRELRKKYGENIVSKDGPIPAHLLGNPWAQTWNIANFTVPFSGKQLPDVSAAL
IEQDYNATSMFRLAENFFISINLTAMPDTFWKKSILTKKDGVDMICHASAWDFYNAEDFR
IKQCTRINMEDLLTAHHEMGHIEYYLQYKNQPVVFKEGANPGFHEAVGDVISLSVSTPSH
LKKIGLLMDDSTDREAFLNHLYMKSLDKIVFLPFAYMMDRWRWNVFQGKVTPDNYNCNWW
TLAEEYQGIEPPVDRSEEDFDPGSKYHIIAGVEYIRYFVSFVIQFQFHKALCIEAKQYDP
SNPNAKPLSQCDIYDNKDAGNLLKSMLELGSSKPWQDAMEKISGQRQMDAAGLLEYFKPL
TDWLTEENKKTNEYIGWKHSKKQCVQTRGELVNYSY
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcctaatattggtagcagtagttataactctagtggcagccaaaccaacgacc
gaagatgcagatatcaaaagcgaaacttccgacgatcttctgaaaagcgctcacgaactt
ttgaaacgaatcgatgcagagtatgcaaaatggaataatatacagagtatcaccgcatgg
aattacgcatcgaatctaacgaatgagaatctagcagaaaagttgaaatgctcggcagag
ggggcaaacgttaccaaacatattattcaaatagtgaatgacttcccttggagagacttg
aaaaatgagtctatgaagagacagttcaaaaaactcagtatactcggtgtcgccgctctc
cctgaacaaagttataatgaatttgagatgacggtaagtaaaatggagaacatctatagc
accgcaaaaatctgcgattatcacaacaagagcaagtgtgatcttgcacttgaaccagaa
attattgagatatcaaagagtagtcacgatcctgaggagctgaaacatatttgggtggag
tggaggaaagtatcaggcgagaaagtcaaatctctgtactccaaatatgttgagctagcg
aacactgtggcgacactcaacaacttctctgactatgcagcattttggatgaaggattac
gaggctgataatttccctgaacaaatcgagactcaatggcaacaactgaagccactatat
ttacaactgcatgcttatgtacggcgcgagctcaggaagaaatacggcgaaaacattgtc
tccaaagacggcccgatcccagcacatctattgggcaatccctgggctcagacttggaat
attgcaaatttcaccgtaccgttctcgggcaaacaactgccggatgttagtgccgctttg
atagaacaagattacaatgcgacaagcatgttccgtctcgctgagaatttcttcatatca
attaacttgactgccatgccggacacattctggaaaaaatcgattctgacaaagaaggat
ggtgtagacatgatctgccatgcgagcgcatgggatttctacaatgccgaagatttcagg
atcaagcaatgtacgcgcattaacatggaagacttactaacagcgcatcatgagatgggt
cacatcgagtattacttgcaatacaagaaccagcctgtagttttcaaggagggcgcgaat
ccaggtttccatgaggcggttggtgatgttatttctctcagcgtatctactcccagtcat
ctcaaaaagatcggtctattaatggatgactcgactgatcgggaggcattcctcaatcac
ctctatatgaagagtcttgacaagattgtcttcctgccattcgcttacatgatggaccga
tggcgttggaacgtattccaaggaaaagtcacgccagacaattataattgcaactggtgg
acactcgccgaggaataccagggcatcgaacctcccgtagataggtcggaagaagacttc
gatcctggctcaaagtatcatataattgcgggtgtcgagtatataagatactttgtaagc
tttgtgatacagtttcagtttcacaaggcattgtgtatcgaagcgaaacaatatgatccg
agcaatccaaatgccaaaccattgagtcaatgtgatatttacgataataaggacgccgga
aatctgctaaaatctatgcttgagttgggttcttcgaaaccgtggcaagacgcgatggag
aaaatctctggtcaaaggcaaatggatgcagctggacttttggaatattttaagcctttg
actgattggctgaccgaagaaaataagaaaactaatgaatacattggatggaaacacagt
aaaaaacaatgtgtacagacgagaggagagcttgtgaattacagctattga

DBGET integrated database retrieval system