KEGG   Atta cephalotes (leaf cutting ant): 105627154
Entry
105627154         CDS       T04923                                 

Definition
(RefSeq) uncharacterized protein LOC105627154
  KO
K16679  wengen
Organism
acep  Atta cephalotes (leaf cutting ant)
Pathway
acep04013  MAPK signaling pathway - fly
acep04214  Apoptosis - fly
acep04215  Apoptosis - multiple species
acep04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:acep00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    105627154
   04391 Hippo signaling pathway - fly
    105627154
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    105627154
   04215 Apoptosis - multiple species
    105627154
SSDB
Motif
Pfam: TNFR_c6 CD225 Trp_oprn_chp
Other DBs
NCBI-GeneID: 105627154
NCBI-ProteinID: XP_012063830
UniProt: A0A158P222
LinkDB
Position
Unknown
AA seq 339 aa
MPRESCPGLLLTLVSIFVGLCESSAAPGAATSGTQQPQPQPQQQPPPQSQQQHPICRPGL
EFWSTERASCWPCTRCAPEFTLSPCVIHKDAICGPLSALELDWSFLSSTGRKRPSRAGDD
NGTVTSNAFLRFSEERTKERPFVETDNLINPGREGDKEPVSASQESKTAYDPRERRKSAV
EDNLPWDWQTGALVLAVCACIVFFLVAGCSAIVYARQWRRMKRNFEPAGLEEISARLNLM
VKAELAELVAGAPMNPGDPETRCQYLEKLLDRKRETPVVATAATATTVATAAAGWPEAAT
GNLYIEEGGTTTPRSKRSQIARIQRNIETILSHKTNQGD
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgccgagggaatcctgtcccgggttactgttgaccctggtgtcgatattcgtcggcctg
tgcgagtcctctgctgcccccggagccgcaacatccggcactcagcaaccacagccgcag
ccacagcagcagccgccgccgcagtcgcagcagcagcatccaatttgtaggcctggtttg
gagttctggtccaccgaacgcgcctcgtgctggccgtgtactcgatgcgcccccgaattc
accttaagtccatgtgtgattcacaaggacgcgatatgcggcccactatcagcgctcgag
ctcgactggtccttcttgtcatcgacgggcaggaagagaccctcgagagccggtgatgac
aatgggaccgtcacctcgaacgcgttcctgcggttctctgaggagaggacgaaagaacga
cccttcgtggaaaccgataatctcatcaaccccggtcgtgaaggcgacaaggagccggtc
tccgcttcgcaggaatcgaaaacggcgtatgatcctcgggagaggagaaaatcagccgtt
gaagacaatctaccgtgggactggcagaccggtgctctggtccttgcggtatgcgcctgc
atagtattcttcctggtagcaggatgctcggctatcgtctacgcgaggcaatggcggcgg
atgaagaggaacttcgagccggcgggtctcgaagaaatctcagccagattgaacctgatg
gtgaaagcggagctggccgagttggtcgcaggagcaccgatgaatccaggtgatcccgaa
accagatgtcagtatctcgagaagcttttagaccggaaacgggagactcccgtggtggcg
acggcggcgacggcgacgacggttgcaacggcggcggctggctggccggaggcagcaacc
ggcaacttgtacatcgaagaggggggcacaacgacaccgagaagtaaacgatcgcaaatc
gcacggattcaacgtaacatcgagaccattctcagtcacaagacgaatcagggcgattga

DBGET integrated database retrieval system