KEGG   Acetobacter sp. JWB: DS739_05880Help
Entry
DS739_05880       CDS       T05544                                 

Definition
(GenBank) 2-nitropropane dioxygenase
  KO
K02371  enoyl-[acyl-carrier protein] reductase II [EC:1.3.1.9]
Organism
acet  Acetobacter sp. JWB
Pathway
acet00061  Fatty acid biosynthesis
acet01100  Metabolic pathways
acet01212  Fatty acid metabolism
Module
acet_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:acet00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DS739_05880
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:acet01004]
    DS739_05880
Enzymes [BR:acet01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     DS739_05880
Lipid biosynthesis proteins [BR:acet01004]
 Fatty acid synthase
  Component type
   DS739_05880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NMO ThiG IMPDH
Motif
Other DBs
NCBI-ProteinID: AXC26360
LinkDB All DBs
Position
1231362..1232447
Genome map
AA seq 361 aa AA seqDB search
MMSDIASSLNPAPTSEEWQRARTRLDKLWQRGTDFLGTPYAILAGAMSWVSERHLVSAIS
NAGGFGVIACGAMEPARLAEEIAATRALTDRPFGVNLITMHPQLDELVQVCLDAKVGHIV
LAGGIPPSAAIKAAKDGGAKVIGFAPALVLAKRLIKMGVDALVIEGAEAGGHIGPVSLTV
LAQEILPHIQNVPVFVAGGLGRGDALVSYLEQGAAGGQFGTRFAAAEESIAHENFKKAFV
RANARDATTSVQLDERFPVIPVRAISNEGGRKFVAHQADVIRRFQAGDLTREDAQLEIEH
FWAGALRRAVIDGDVEEGSVMAGQSVGMVKSVQPVAQIIADLIDQAVIALIRQQRRMDAD
G
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgatgtctgatattgcaagcagcctgaatcccgctccaacgtctgaagaatggcagcgc
gcccgcacgcggttggataagttgtggcaaagggggacggattttctgggcacgccttac
gccattttggctggggcaatgtcttgggtgagtgaacgtcaccttgtatccgccatttcc
aatgcaggtgggtttggtgtgattgcctgtggtgctatggaaccagcccgtttggctgag
gaaattgccgccacccgtgcgctgacagatcgcccttttggcgtaaatctgattaccatg
caccctcagttggatgagctggtgcaggtgtgtctggatgccaaggtgggccatattgtg
ctggcaggtggtattccgcccagcgccgccattaaggccgccaaggatggtggcgccaag
gttattggctttgccccagcattggtgttggccaagcggctgatcaagatgggtgtggat
gcgctggtcattgaaggtgcagaagcaggtggtcatatcggccccgtttccctgactgtg
ctggcgcaggaaattctgccgcatatccagaacgtgccggtttttgtggctggcggcctt
ggccgtggtgatgcgcttgtttcctatttggagcagggcgctgctggtggccagtttggt
acacgttttgctgcggcagaggaaagcattgcccacgaaaactttaaaaaagcttttgtg
cgggccaatgcgcgtgatgctacgacctcggttcagcttgatgaacgctttccggttatt
ccggtgcgggccatcagcaatgagggcgggcgtaaatttgtagcgcatcaggccgatgtt
atccgccgctttcaggcgggtgatctcacgcgtgaagatgcgcaactggaaatcgaacat
ttctgggcgggtgccttgcggcgtgcggttattgatggagatgtagaagaaggctctgtt
atggccgggcaatctgttggcatggtaaaatctgtgcagccggtggcccagattattgct
gacctgatagatcaggccgtgatagcgctgatccgtcaacaacgccgcatggatgctgat
ggctga

DBGET integrated database retrieval system