KEGG   Acetobacter sp. JWB: DS739_09855Help
Entry
DS739_09855       CDS       T05544                                 

Definition
(GenBank) amino acid permease
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
acet  Acetobacter sp. JWB
Brite
KEGG Orthology (KO) [BR:acet00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    DS739_09855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C
Motif
Other DBs
NCBI-ProteinID: AXC27032
LinkDB All DBs
Position
2085159..2086640
Genome map
AA seq 493 aa AA seqDB search
MEQKSAPSVTSAFTRCLPLDKLQAAPGLKRVLGPGSLVALGVGATIGAGLFSLTGIAASE
NAGPAVVLSFFIAAIACGFAGLCYSELASMIPIAGSAYTYAYVTLGEMMAWIIGWDLVLE
YAVGAATVAVSWSRYVVSLLDSWGIVLPPRLTTSPFETVQMPDGSMVSGLMNLPAVFITC
LVSWILIRGISQSAMVNAVVVVIKLLVITAFIGFGIHYINPANYHPFIPQNTGTFGQYGW
SGIMRAAGTIFFAYVGFDAVSTTAQETKNPARDMPIGILGSLLICALAYVCFSFVMTGLV
NYKDMLGDAAPVATAINRTPYTWLQLAIKIGIICGFTSVLMGMLLGQSRVFFAMSRDGLL
PPMFSATHPKYQTPWMSNVFFMLIICLLSAFLPISELGHMTSIGTLLAFILVCAGVMILR
RKAPDHPRAFRVPGGDIIPILGILSCGTVMVSLDGLTWIRLVVWLAIGMVIYLTYGRYHS
ALARPSIPPDRVA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggagcagaagtctgccccctctgtaacatcggcatttacgcgatgtttaccgctagac
aagctacaggcagcaccggggcttaagcgtgttctggggccgggaagccttgtagcgttg
ggtgttggcgccacaattggggctggactattttctcttaccggcattgctgcttctgaa
aatgctggacctgctgtggttctttccttttttattgcagccattgcctgtggctttgcc
gggctctgctacagcgaactggccagcatgatccccattgcgggaagtgcttatacctat
gcgtatgtcacgctaggcgaaatgatggcatggattattggttgggatctggtgctggaa
tacgccgttggcgcggccactgttgcggttagttggtctcggtatgtggtgtccttattg
gattcgtgggggatcgtgctgcccccacggcttacgacctccccctttgaaaccgtgcag
atgcctgatggcagcatggtttcagggctgatgaacttgcccgcagtttttattacctgc
ctggtttcatggatccttattcgcgggatctcgcaatccgctatggtgaatgccgttgtg
gtggtcatcaaactattggtgattacggcgttcattggctttggcatccactacatcaac
ccggccaactatcacccgtttatcccacaaaatacaggcacctttgggcagtatggctgg
tctggcatcatgcgcgctgcgggcaccatcttttttgcctatgtggggtttgatgccgtt
tccaccacagcgcaggaaaccaaaaacccggcgcgtgatatgcccattggtattttgggc
agcttgctcatttgcgcgttggcttatgtttgcttctcttttgtaatgaccggtctggtc
aattacaaagacatgctgggagatgccgccccggtagccacagccattaaccgcacgccc
tatacatggctgcaacttgctatcaaaattggcattatttgtgggtttacatccgtgctc
atgggtatgcttttaggccagagccgcgtgttttttgccatgtcccgcgatggtctgctg
ccccccatgtttagcgccacacatccaaaatatcagacaccttggatgtccaacgtcttt
ttcatgcttatcatctgcctgctaagcgcgtttttgcctatttctgagctggggcacatg
acatccatcggcacgcttctggcttttattctggtatgcgctggcgtaatgatcctacgc
cgcaaggcacctgatcatccacgtgcctttcgggttcccggcggagacattattcccatt
ctgggtattctctcctgcggcacggtcatggtctcgctggatggactgacatggatccgg
ctggtcgtatggctggccatcgggatggtgatttaccttacctatggccgttaccatagc
gcattagcgcgacccagcattccgccagacagggttgcataa

DBGET integrated database retrieval system