KEGG   Aciduliprofundum sp. MAR08-339: AciM339_1502Help
Entry
AciM339_1502      CDS       T02396                                 

Definition
(GenBank) aldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
acf  Aciduliprofundum sp. MAR08-339
Pathway
acf00030  Pentose phosphate pathway
acf01100  Metabolic pathways
acf01120  Microbial metabolism in diverse environments
acf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:acf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AciM339_1502
Enzymes [BR:acf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     AciM339_1502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AGB05355
UniProt: L0HMU5
LinkDB All DBs
Position
complement(1364213..1366030)
Genome map
AA seq 605 aa AA seqDB search
MYGYWGKILRVNLSTGEIKTESFNEEFVKKWLGTRGFGIHYLLKEMDPKADPLGEENKLI
FSTGALTGTTAPTGGRYMVITKSPLTGFIAMANSGGFFGAELKMSGWDMLIIEGKSDKPV
YLRIEDEKVEIRDASHVWGKRVSETEKILTEEFGDKHVQIASIGPAGENLVKFSAIMNNG
HRAAARGGVGAVMGSKKLKAIVVRGHKRVEVIDRSKFISVVREKTEILKKDPVAGQGLPS
YGTAVLVNIINQNGLYPTRNFRYGQFEYAEEQSGEAMAKKYLKRNKPCYACPIGCGRVND
MDTVGETEGPEYESTWALGANLGINDLASIIEANHMCDEYGLDTISTGGTLATAMELYDQ
GYLKQEDLGDAPPFRWGNTEVLHYYIPKIARREGFGAILAEGGYRLAEKYGCVDCFMGVK
KQELPAYDPRGAEGHGLGYATDNRGGDHIKAYLISPEILGYPFKMDPHDISDEKVKMLIL
FQDLTAVIDAAGMCVFTTFGMGGDDYRDLLNAAFGYNLSTEDWLKIGERIWNAERLFNLK
AGLNPLEDDTLPKRLTEEPMPEGPNKGHVVRLKEMLPRYYALRGWNEDGTISEDKIKELG
LEEYL
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtatggatattggggtaagatacttagagtgaaccttagcacgggagagataaaaacg
gagagttttaatgaggaatttgttaaaaaatggctcggcacgaggggtttcggcatacac
tatcttctaaaggagatggatcccaaagcggaccctctgggcgaggaaaacaagcttatt
ttctccacaggagcgctcacgggcacaactgcacccaccggcggaaggtacatggttata
acgaagagtcctcttaccggcttcattgcaatggccaactctggaggattttttggcgcg
gaacttaagatgtctggatgggatatgttgatcattgaaggaaagagcgacaagcccgtt
tatctgcgcattgaggatgagaaggttgagataagggatgcctcgcatgtatggggaaag
agggtgagtgagacggagaagattctaacggaggagtttggagacaagcatgtccagatt
gcgtccataggtcctgcgggggagaatcttgttaagttctctgcaataatgaacaatggc
cacagggcagctgcaaggggaggagtgggtgcagttatgggctcaaagaaactcaaggcc
atcgtggtacgggggcataagcgtgttgaggtgattgacagaagcaagttcataagtgtg
gtgcgtgagaagacggagatactcaaaaaggacccggtcgctggacagggtttgccatcc
tacggcaccgcagtactggtgaacataatcaatcagaatggcctgtatccaacacgcaat
ttccgttacgggcagtttgaatatgcggaggagcagagcggagaggccatggcaaagaag
tacctgaagagaaacaagccatgctacgcctgccccatagggtgtggccgtgttaacgat
atggatacagtaggtgaaactgagggacctgagtatgagagcacatgggccctcggtgcc
aatctcggcataaatgatctggccagcataattgaagcaaaccacatgtgcgatgagtat
gggcttgacacaatatccacaggaggcacgctggcaacggccatggaactctacgaccag
ggatatttgaaacaggaggatcttggagatgcccctccattcagatggggaaacaccgag
gttctgcattactacataccaaaaattgcgagacgtgaagggtttggtgccatactcgca
gaaggtggttacagactcgctgagaagtacggatgtgttgattgcttcatgggagtgaag
aagcaggagcttcctgcgtatgatcccaggggggcagagggtcatggacttggatacgcg
acggacaatcgcggtggagaccatataaaggcgtacctcatctcacctgagatcctcggt
tatccgttcaagatggacccgcacgatatcagcgatgagaaggtgaagatgctcattcta
ttccaggatctaaccgcagtcatagacgctgcaggaatgtgtgtgttcaccaccttcgga
atgggtggtgatgattacagagacctgctcaacgctgccttcggttataacctcagcacg
gaagattggcttaagatcggagagagaatatggaacgcagagcgtcttttcaacttgaag
gctgggctcaatccactggaggatgataccttgcctaagcggctcactgaggagcctatg
ccagagggtccaaacaagggccatgttgtccgcttgaaggagatgcttccaaggtactat
gcccttaggggttggaacgaagatggcacgatatctgaggataagataaaggaacttggg
ctggaggagtacctctaa

DBGET integrated database retrieval system