KEGG   Aerococcus christensenii: AWM71_02885Help
Entry
AWM71_02885       CDS       T04262                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
acg  Aerococcus christensenii
Pathway
acg00620  Pyruvate metabolism
acg00680  Methane metabolism
acg01100  Metabolic pathways
acg01120  Microbial metabolism in diverse environments
acg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:acg00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AWM71_02885
  Energy metabolism
   00680 Methane metabolism
    AWM71_02885
Enzymes [BR:acg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AWM71_02885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AMB92325
UniProt: A0A0X8F842
LinkDB All DBs
Position
606730..609555
Genome map
AA seq 941 aa AA seqDB search
MSIKKLETNITQSTIPEEIEVLKSLLDETTHKMVGDQIFKKIQTLVTLSQEANYTQLEKE
VTQLSNDEMVFVSRYFSILPLLINISEDVNFAYEINYQNNKSEDYLGKLSLSIDKASQSK
KAQEILEHINVVPVLTAHPTQVQRKTILELTSHIHKLLRKYHDVKAGVVNRKKWITDLHR
YIEIIMQTDIIREKKLKVKNEIENVMVYYNNSLIPAITKLTSEYKRLATEKGLSLTNPKP
ITMGMWIGGDRDGNPYVTAETLRLSASVQSELILNYYIEKLSKLYRTFSLSTNLSKISPE
VEKLAELSSDTSVFRENEPYRKAFNYIQSKLIQTLIELKTGSSLSQRILENSQILNANTF
ASSKNASVISKYLQTKFSKVSTTLQVEKPSYKTAQEFKNDLLTIKQSLLDNGDSALLTGD
FSELLQAVDVFGFFLATIDMRQDSSVNEACVAELLKSANIVENYSELPEREKIKVLLKEL
TEDPRTLSSTHAEKSELLKKELAIFQTARYLKDKLGDEVIKQHIISHTESVSDMFELAIM
LKEVGLLDNQTARIQIVPLFETIKDLENSTAILAEYLDYDIVKKWVSANKDYQEVMLGYS
DSNKDGGYLSSVWSLYKAQNQLTAIGADRGIKVTFIHGRGGTVGRGGGPSYEAITSQPFG
SIKDRIRLTEQGEIIENKYGNRDVAYYNLEMLVSATINRIVPHKATDSDEIEAFDEIMED
VVTYSNKVYCDLVFNNPYFYDYFFEASPIKEVSSLNIGSRPAARKTITEITGLRAIPWVF
SWSQSRIMFPGWYGVGSAFKHFIEEKDGNLEKLQKMYAKWPFFHSLLSNVDMVLSKSNMN
IAAQYAKLAKTQEVRDIFTIIQKEWQTTKEVILAIEKHDDFLEEIPSLHASLEYRLPYFD
VLNYIQIELIKRLRHDELDEGYEKLIHTTINGIATGLRNSG
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatcaagaaattggagactaacatcacccaatctaccataccagaggaaattgaa
gtcttaaaaagcttacttgatgaaactacccataaaatggtgggggatcaaattttcaaa
aaaattcaaaccctcgtcaccctatctcaagaagcgaactacacccaacttgaaaaagag
gtcactcaattatccaatgacgaaatggtgttcgtctctcgttatttttccattttgcca
cttttaattaatatttcagaagacgttaactttgcttatgaaattaattaccaaaataat
aaaagtgaagactatctaggcaagctttctctaagtattgataaagcttctcaaagtaaa
aaagctcaagaaattcttgaacacattaacgtggttcctgtcttaacagcgcatcccaca
caagttcaacgaaaaacaattctagagctaaccagtcatatccataaactgttaagaaaa
taccacgatgtcaaagctggtgttgttaaccgtaaaaaatggattactgatttgcaccgt
tacattgaaatcattatgcaaaccgatattattcgtgagaaaaaattaaaagttaaaaac
gaaatcgaaaacgtaatggtttattacaacaactctttgatccctgctattacgaaacta
acgtcagaatataaacgtttagcaacagaaaagggactctccttaaccaatcccaaacct
attacgatgggaatgtggatcgggggagaccgggacgggaacccttacgtgacagcagaa
accttacgcttatcagcttctgttcaaagcgaactcattctgaactactatatcgaaaaa
ctatccaaactttatcggactttttctctctctactaatttgagtaaaatcagtccagaa
gtagaaaaattagcagagttatcctccgatacttctgtctttcgtgaaaatgaaccttat
cgaaaagcctttaattacattcaatctaaacttattcaaaccttaattgaattaaaaaca
ggctcttcactttctcaacgaattttagaaaacagccaaattctcaatgcgaatactttt
gctagttctaaaaatgcaagcgtcatttcgaagtatcttcaaacgaaattttcaaaagtt
tctacgactctccaagtagaaaaaccaagctataaaactgctcaagaattcaaaaacgac
cttttaactattaagcagtccttgctcgacaatggtgattctgctttattaacaggcgat
tttagtgaattactccaagcagtagatgtcttcggattcttcttggcaacaattgatatg
cgtcaagattccagcgtcaatgaagcctgtgtcgctgaattattaaaatcagccaatatc
gtagagaattatagtgagttacctgaaagagaaaaaattaaagttcttcttaaagaatta
acggaagatcctcgtaccctctcttccacacatgctgaaaaatctgaactccttaaaaag
gaattggctattttccaaacagcccgctatctcaaagataaattgggcgatgaagtcatt
aaacaacatatcatttctcacacagaaagtgtttctgatatgttcgaattggccattatg
cttaaggaagtcggcttactcgacaatcaaacggctcgtattcaaattgttcctctcttt
gaaacgattaaagaccttgaaaactcaaccgcaattttagcagaatacctcgattacgat
atcgttaagaaatgggtaagtgctaataaggactaccaagaagtcatgctcggttactca
gatagtaacaaagacggtggctatctctcctctgtatggtctctttataaagctcaaaat
caattaacggctattggagcagaccgaggaataaaagtcacctttattcacggtcgtggg
ggcactgttggacgtgggggtggtccatcttatgaagcaatcacctctcaacctttcggc
tccatcaaagaccgcatccgcttaaccgaacaaggcgaaattattgaaaataaatatggg
aaccgagatgttgcctactacaatttggaaatgttagtttcagctaccatcaaccgtatt
gttccacataaggctacagattctgatgaaatcgaagcctttgatgaaatcatggaagat
gtggttacttattcaaacaaagtgtactgcgatttagtctttaataatccttacttctat
gactatttctttgaagctagtccgattaaagaagtttccagtttaaatattgggtctcga
cctgctgctcgcaaaaccattacagaaattactggacttcgtgccattccttgggtattt
tcttggtcccaaagtcggatcatgttcccaggatggtatggcgttggttctgccttcaaa
cacttcatcgaagaaaaagacgggaacttagaaaaactccaaaaaatgtatgccaaatgg
ccattcttccactctcttctctccaacgtggatatggttctctctaaatctaacatgaat
atcgctgctcaatatgctaaattagccaaaacacaagaagttcgtgatatttttaccatc
attcaaaaagaatggcaaacaacaaaagaagtcatcctagctattgaaaaacatgatgat
ttcctagaagagattccttctcttcacgccagcttagaatatcgacttccttacttcgat
gttttaaattatattcaaattgaattaatcaaacgtctacgtcatgatgaattagacgaa
ggatatgaaaaactgattcataccacgattaatgggattgcaacagggcttcgcaactct
ggttga

DBGET integrated database retrieval system